SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000019640 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000019640
Domain Number 1 Region: 380-436
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.32e-18
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 2 Region: 343-393
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.05e-16
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 3 Region: 421-473
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000428
Family Classic zinc finger, C2H2 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000019640   Gene: ENSORLG00000015684   Transcript: ENSORLT00000019641
Sequence length 603
Comment pep:novel chromosome:MEDAKA1:16:24202291:24204424:-1 gene:ENSORLG00000015684 transcript:ENSORLT00000019641 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EESLLEGKHHKLSSEEHLDEASSPSPVRVTPKPPKREHSVLSILRGTNSTSSGSSKREPS
RPLVTRPLCADSPERPLYPRALYPAIRPHPHMSDDFLSHKPSNLGYPSTHSPGNQSSATP
SPSARSSPDSTPQGSPCGPAPSPASFYPTGLGSYPGYSPPSAPLSTQFYSPASPYPRYLL
PHHYPLSGGGVPTVGGMIPRMYPLLHPHVPLLPSDPGRHFLMPEPMHPSSFSSHRDLFLP
GSTSAFTIKTPLIDRAGPHNPYSGLLNPHGPARTPSSGSPTAGTAPPSEQVPTKPTSALL
GNTSEHRTDEEAINLTKVKRGAGSAGYKALPYPLKKQNGKIKYECNVCSKTFGQLSNLKV
HLRVHSGERPFKCQTCSKGFTQLAHLQKHYLVHTGEKPHECQVCHKRFSSTSNLKTHLRL
HSGEKPYHCKLCPAKFTQFVHLKLHKRLHSRERPHKCPHCHRHYIHLCSLRLHLKGYCLA
VNSGSRSPTVSSQAALEEMHRANEEIERFDISEHAERLDQLPGGAEIDTMLEKQVLGMLW
RDTEMKSLHFHPHHKGGSTELLSSGYGSYESAKETSVIKMRRSSPDSSLPVGVTVKQESD
DHA
Download sequence
Identical sequences H2MLR0
ENSORLP00000019640 ENSORLP00000019640 8090.ENSORLP00000019640

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]