SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000019654 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000019654
Domain Number 1 Region: 9-127
Classification Level Classification E-value
Superfamily POZ domain 1.18e-20
Family BTB/POZ domain 0.0055
Further Details:      
 
Domain Number 2 Region: 318-370
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.96e-16
Family Classic zinc finger, C2H2 0.0029
Further Details:      
 
Domain Number 3 Region: 356-400
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000299
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Weak hits

Sequence:  ENSORLP00000019654
Domain Number - Region: 294-329
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00148
Family Classic zinc finger, C2H2 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000019654   Gene: ENSORLG00000015695   Transcript: ENSORLT00000019655
Sequence length 423
Comment pep:novel chromosome:MEDAKA1:9:25263142:25264478:1 gene:ENSORLG00000015695 transcript:ENSORLT00000019655 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQNQVILQFHFATFGDSMLQKMNLLRHQRRFCDVTVRINQLEVPGHKVVFAAGSSFLRD
QFILQQDSKEVQISMIQEAEVGRQLLLSCYTGQLEFPELELVHYLTVASFLQMGHIVEQC
TQALSKFIKPEASHQLRVDVDRKREKKRQEGLPSPAHREQSQVQTVLVVGQVEEDTNDDS
DDDVIIQPKSPVQSLTRHSRQSMVENDITIVKVESVSNAAETSITGNFSATPPTALQSPE
PQHSLINSTVDSRCSEMAAPPGMPRYPLSPPPQSPPAEKHSGHQRNYDKPLQWYHQCPKC
ARVFRQLENYANHLKMHKLFMCLLCGKTFTQKGNLHRHMRVHAGIKPFQCKICGKTFTQK
CSLLDHLNLHSGDKPHRCNYCEMVFAHKPVLRKHLKQIHGKNSFDNNRGNLHEGGLEFDF
SQV
Download sequence
Identical sequences H2MLS0
ENSORLP00000019654 8090.ENSORLP00000019654 ENSORLP00000019654

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]