SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000019690 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000019690
Domain Number 1 Region: 2-98
Classification Level Classification E-value
Superfamily POZ domain 2.75e-24
Family BTB/POZ domain 0.0061
Further Details:      
 
Domain Number 2 Region: 341-374
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000522
Family Classic zinc finger, C2H2 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000019690   Gene: ENSORLG00000015723   Transcript: ENSORLT00000019691
Sequence length 441
Comment pep:novel chromosome:MEDAKA1:24:11767876:11769604:-1 gene:ENSORLG00000015723 transcript:ENSORLT00000019691 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEVSSHSLFLLQQLNVQREFGFLCDCTVAIGNVYFKAHRAVLAAFSNYFKMIFIHQSSEC
IKIQPTDIQPDVFSYLLHIMYTGMCPKQPVDQSRLQEGIKFLHAYQLCRKPGEATADAAA
DAVRMSNLYGIQISSQLANKGVPGVPKATTVSRGTPEDGSSMDRGVRSHSQLSLAVGLEG
VHSDPQALRNICSVASGDDSDISARIKQECVEEEDGEGREGTVVGSPGQGCSPSQGPLAE
PKEHALVLLCPRCGERCSSPEGLQEHLFSHALNPARLIEGLSQGGELDAGVEEGPPGAQE
QLDAGCLEEALRQSQALANQLAAELRRSRGGGGSNSPAPTTLHSRKRKIACAVCSLRFTH
KSQLQEHMYTHTGKPGRYHRYGRLCSQLFQSSTHFCEGGTDAGGASALSEDANRDAQDNG
SSCYSLDSEVSQESVDGVPVE
Download sequence
Identical sequences H2MLV5
8090.ENSORLP00000019690 XP_004083848.1.28442 XP_020570451.1.28442 ENSORLP00000019690 ENSORLP00000019690

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]