SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000019696 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000019696
Domain Number 1 Region: 3-112
Classification Level Classification E-value
Superfamily POZ domain 2.51e-24
Family BTB/POZ domain 0.0017
Further Details:      
 
Domain Number 2 Region: 530-579
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000102
Family Classic zinc finger, C2H2 0.02
Further Details:      
 
Domain Number 3 Region: 588-639
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000759
Family Classic zinc finger, C2H2 0.029
Further Details:      
 
Weak hits

Sequence:  ENSORLP00000019696
Domain Number - Region: 220-251
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00115
Family Classic zinc finger, C2H2 0.035
Further Details:      
 
Domain Number - Region: 634-663
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0417
Family Classic zinc finger, C2H2 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000019696   Gene: ENSORLG00000015729   Transcript: ENSORLT00000019697
Sequence length 668
Comment pep:novel chromosome:MEDAKA1:24:11774004:11776058:1 gene:ENSORLG00000015729 transcript:ENSORLT00000019697 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARPSHSDHVLQQLNNQREWGFLCDCLIAIGDIYFRAHKAVLAACSSYFRMMFIRDQQGA
GRLDLSNMQISAECFDLILQLMYLGRIVVGSYEFEELKASMVYLQMYYIPDSLEDLRDIR
SSNLTGVCGGKMMFGVRMYEQQRPAPPEGEQTAKAVSGGAGGRPFAPAADSRPGGSDDVT
TTPLIVAPPAADVTAEQPCDLRKRSGGRSSALKERPRFGRTYTCDDCGFVFSCEKLLIEH
ILTCTNRKAFHPPRGNMEGDNDSSKAESSASESTEEHRVVCKGEDYWPETKGDSDLSVRL
VAAETAGEPGSTQNIKTEPEESVFPEIEMIQVGEIRDCKPRSGATTYKDSLREHMGSDQE
PEPGVSGLESSGELLEGHLSSSNDEGILTKRRKVKDEKQEADRAPCELCGTLLTEEDKSG
HYLSNHMGHICACGRCGQVLIKGRQLQEHAERCGESHGGDSDSHGDDDVSLLGEPQGMEE
GLLEVTDLACPHCGLPFQNETLALEHALSCHDQDLYRPVALDEGGEPDHRRKHFCSICGK
GFYQRCHLREHYTVHTKEKQFTCQTCGKQFLRERQLRLHTDMHKGMARYVCPLCDQGTFL
KHDHVRHMISHLSAGETICQVCFQIFPGGEQLEKHMDVHLYICGVCGEKFRLRKDMRSHY
NSKHTKRL
Download sequence
Identical sequences H2MLW0
8090.ENSORLP00000019696 ENSORLP00000019696 ENSORLP00000019696

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]