SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000019752 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000019752
Domain Number 1 Region: 87-203
Classification Level Classification E-value
Superfamily PH domain-like 8.31e-30
Family Pleckstrin-homology domain (PH domain) 0.0019
Further Details:      
 
Domain Number 2 Region: 3-92
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.96e-24
Family DBL homology domain (DH-domain) 0.00065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000019752   Gene: ENSORLG00000015774   Transcript: ENSORLT00000019753
Sequence length 221
Comment pep:novel chromosome:MEDAKA1:24:11928612:11932566:1 gene:ENSORLG00000015774 transcript:ENSORLT00000019753 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LRDKSTAQFFRDRQASLKRTLPLGSYLLKPVQRILKYHLLLQEIAKHFDPEEEGYEDVEE
AINTMTGVAWYINDMKRKHEHAVRLQQEVQSLLLNWKGPDLASYGELVLEGTFKVHRAKN
ERTLFLFDRMLLFTKRRGEHYVYKTDIPCTTLMLIESAKDSLSFSVTKYKNPKQPYTVQA
KTVEEKKLWAHHIKRIIVENHHAVIPQKAKEAILEMDSICE
Download sequence
Identical sequences H2MM15
ENSORLP00000019752 ENSORLP00000019752 8090.ENSORLP00000019752

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]