SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000019811 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSORLP00000019811
Domain Number - Region: 40-80
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00506
Family HkH motif-containing C2H2 finger 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000019811   Gene: ENSORLG00000015819   Transcript: ENSORLT00000019812
Sequence length 252
Comment pep:novel chromosome:MEDAKA1:16:24642427:24645372:-1 gene:ENSORLG00000015819 transcript:ENSORLT00000019812 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSFKREGNDGSQLNILKKRRVSDLLSNFIPEDEAALLSNGRYTCLVCSYRPVFDTVDMLT
VHRQGKKHLEGLKSFYGKKSKFKNEIAKRKHEDYVRAEDKEEPSSSAPLLAQTRKLTHHA
LLKTVPYNSCHRKTRLVIITKLNKGQSSTAGNTFQHNFPSACWKPEVSDNASTSDSSDCF
TVESCSSKDRIQCQSESRQTAELITPQRRREMEHYLKLKSNGWLQDGNGQWVKDNNVEFD
SDEETPPSFAPS
Download sequence
Identical sequences H2MM72
ENSORLP00000019811 8090.ENSORLP00000019811 ENSORLP00000019811

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]