SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000019938 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000019938
Domain Number 1 Region: 59-112
Classification Level Classification E-value
Superfamily Hermes dimerisation domain 5.62e-16
Family Hermes dimerisation domain 0.0085
Further Details:      
 
Domain Number 2 Region: 10-51
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000274
Family BED zinc finger 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000019938   Gene: ENSORLG00000015926   Transcript: ENSORLT00000019939
Sequence length 119
Comment pep:novel chromosome:MEDAKA1:9:25586507:25594057:-1 gene:ENSORLG00000015926 transcript:ENSORLT00000019939 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPGPKRKFSPTWEYFDMISPTKVKCRICDKEVGYNNNTSSMIRHHRSFHEPGDRPSKDS
RKQLLDDALVDMVIKDSQPFSVVEDEGFRNFVDLLDPTYILPTKKALKTMVAVKSINPK
Download sequence
Identical sequences H2MMJ4
ENSORLP00000019938 8090.ENSORLP00000019938 ENSORLP00000019938

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]