SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000019964 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000019964
Domain Number 1 Region: 176-234
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.32e-18
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 2 Region: 219-271
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.46e-16
Family Classic zinc finger, C2H2 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000019964   Gene: ENSORLG00000015950   Transcript: ENSORLT00000019965
Sequence length 801
Comment pep:novel chromosome:MEDAKA1:21:20330435:20337318:1 gene:ENSORLG00000015950 transcript:ENSORLT00000019965 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNAEDKLEGMLLRCGSGGIDGGSRVSLGGGGLVVMTLGERSLANHPLLAEDEDDEDDDED
LTGNSLVTHDLVPPEQLMMQEEGTKNGEVGVHFPLKLTNKLPYLLHVPMNIKQELKLSDP
AAHKKKDQKAIKDLIVSPKKKKRKQRSPAKILNMNEEGLLGLQNPKCHICVHCNAAFRTN
YHLQRHVFIHTEGEKPFQCSQCDMRFIQKYLLQRHEKIHTGEKPFRCDECGMRFIQKYHM
ERHKRTHSGEKPYQCDYCHQYFSRTDRVLKHRRMCHENRERKSSKAAADVGLLREAGSPG
SPLLPKERSLPKKKRQKCAEKNPGASTFAPQTGNLFDVGEAVEKEERSPGKSPSLCSGSS
KVKHEYVIAGYGVEPPEEASGQHEDGPLSAEEATPPKIVLKKVPKRILKQLGEQTPPCLP
TLSSFDENDKVAQYTFEIVEKQGLLDVEGNTELESVETLQGRPPKPAASSTNYDDAMQFL
KKKRYLQAAAASTNSVRDYGSISCQPATAQTVVSTIIDETVPATILDPQPINADLKAPHE
KHVLPDEVLQTLLDHYSNKANGQSDISFSEADTEVTSSISINSSDVSDSSPMESLGASSV
QPHASTEKVSLLQEYSKFLQQALERTSQNDSYLTSQSLSLVSENPTLAGQPLFSTEKQFP
SPGRFKSGLSSPLRSTLDKPHFGLLVGDSQHSFSFSGDETTTPSAVSPSEDDFLDQVSPS
KKSDSSQGILQTFQISSFDQNFKSHFHASRSGPSSQFTVANGQVSVRGPSTDFSEFPLVR
VTETRSQLNSSPDVSTSESFG
Download sequence
Identical sequences H2MML9
8090.ENSORLP00000019964 ENSORLP00000019964 ENSORLP00000019964

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]