SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000020085 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000020085
Domain Number 1 Region: 289-343
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.3e-22
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 2 Region: 250-300
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000653
Family Classic zinc finger, C2H2 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000020085   Gene: ENSORLG00000016049   Transcript: ENSORLT00000020086
Sequence length 362
Comment pep:novel chromosome:MEDAKA1:5:29420362:29423882:1 gene:ENSORLG00000016049 transcript:ENSORLT00000020086 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTKLQFLNVFLTERLMLAAQEIYKSVEDTILEYQEEIAIRERENDHLRRRLRDAGIEIWP
DRPSMSLLEEEDGEHPRREWSPSMGHEERIPLQIKDKRDLRGNQGNDQLRNHGSCSTPDN
MFTPARVANDYPREGPHASSLPQNQGVENRERDAGSRGPSRHVKAESGCGHRGSSSSSGG
AQPLAPVNPNCSNENNIDIIGVENGGQMVGAKGAVNGASRGQAPLMRSQGANAVDCPHQK
SPLQGHMSSFCCKVCGEAFSHVGHLHVHVQVHTREKPYRCGVCGKCCSSSGRLQEHQRSH
TGEKPFRCQICGKGFTQMAHLKVHMRIHTGEKPYSCPVCGKCFSRSDKIKRHLQTHSREG
TY
Download sequence
Identical sequences H2MMY9
ENSORLP00000020085 ENSORLP00000020085 8090.ENSORLP00000020085

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]