SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000020223 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000020223
Domain Number 1 Region: 8-70
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0000000017
Family HLH, helix-loop-helix DNA-binding domain 0.0049
Further Details:      
 
Weak hits

Sequence:  ENSORLP00000020223
Domain Number - Region: 79-98
Classification Level Classification E-value
Superfamily Orange domain-like 0.0706
Family Hairy Orange domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000020223   Gene: ENSORLG00000016162   Transcript: ENSORLT00000020224
Sequence length 201
Comment pep:known chromosome:MEDAKA1:16:26327835:26328740:-1 gene:ENSORLG00000016162 transcript:ENSORLT00000020224 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKLLQDQDESTSNRKLLKSQVEKRRRERMNRSLERLRTMLLPEPHQVTPKHRVEKAEILE
HTVIFLQKTTKEQTRSGQKQSFRDGFSTCLRRASRFLGPQGKGLWLGPALDATFSTRLAR
SDFDSSGLQTRSFSSLQHTRSLLQKLRQKSKDRLRAQVFGAPPVQQSQARAAQPHRHERA
ASKDGSAQSGPLSQTLWRPWP
Download sequence
Identical sequences Q1L7T8
ENSORLP00000020223 8090.ENSORLP00000020223 ENSORLP00000020223 NP_001098280.1.28442

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]