SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000020232 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000020232
Domain Number 1 Region: 149-207
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000323
Family HkH motif-containing C2H2 finger 0.023
Further Details:      
 
Domain Number 2 Region: 93-137
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000338
Family HkH motif-containing C2H2 finger 0.0059
Further Details:      
 
Domain Number 3 Region: 35-78
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000198
Family HkH motif-containing C2H2 finger 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000020232   Gene: ENSORLG00000016169   Transcript: ENSORLT00000020233
Sequence length 229
Comment pep:novel chromosome:MEDAKA1:9:26328802:26488308:-1 gene:ENSORLG00000016169 transcript:ENSORLT00000020233 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDYTISLQVQNQLAVFPTHVCQSYSVELQMKSTEVDQGLFTDSYCKVCSAQLISESQRVA
HYESRKHANKVRLYYMLHPVDGGCPAKKLRTDNGSDESDVDKNKCCTLCNMSFTSAVVAQ
SHYQGKIHAKRLKLLLGEQPAITAKEASPNPSPYPKSSPETSPMTSPRQRRDSDRYCQLC
NAWFNNPGMAQQHYDGKKHKKNAARADLLEQLGKTLDMGEMKGLKKSYT
Download sequence
Identical sequences H2MNC9
8090.ENSORLP00000020232 ENSORLP00000020232 ENSORLP00000020232

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]