SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000020233 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000020233
Domain Number 1 Region: 21-264
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.82e-75
Family Eukaryotic proteases 0.0000252
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000020233   Gene: ENSORLG00000016170   Transcript: ENSORLT00000020234
Sequence length 267
Comment pep:novel chromosome:MEDAKA1:5:29849535:29852914:-1 gene:ENSORLG00000016170 transcript:ENSORLT00000020234 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
HHFLLILLSVILTGEEHLQSIHGGRIIGGTVVQPHSLKYQASLLYRDSHFCGGTLIHPQW
VASAAHCWRPNYMIKVVLGEHNLNKVEGSEQIFSVSLIIKHYQYNYWILDNDIMLLKKMY
ENVFSVLQLDRPANISDMVEPAPLPEKNAPPVENFSQCTVSGWGVTGLYSQSLSSELMSV
SVDYFSNCWSFYYYYSFMITSNMICAGSLDGGKDSCQGDSGGPLVCNGKFEGIVSWGIGC
GYASYPGVYTKVRNYLIWIDQVIQSSP
Download sequence
Identical sequences H2MND0
ENSORLP00000020233 ENSORLP00000020233 8090.ENSORLP00000020233

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]