SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000020264 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSORLP00000020264
Domain Number - Region: 202-229
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0714
Family Classic zinc finger, C2H2 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000020264   Gene: ENSORLG00000016195   Transcript: ENSORLT00000020265
Sequence length 441
Comment pep:novel chromosome:MEDAKA1:24:13387815:13398730:1 gene:ENSORLG00000016195 transcript:ENSORLT00000020265 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAMGPEDRAGAEPVGTAACPFGQHVSAATHGGERPDGQKTLVLTQRCVQAESFHHKSKA
AGQGSQAAPFHNAGSSVHFGNVAGAVEVQNSFRSPESVEMDEIMAAMVLTSLSCSPVIQS
PPQTDPGPAASSSSVDMESGGGELSDSGSSGYWSWDHGNGSPAPSPSVTEMDSSLDEGLQ
LELEPAEEHTAKRPKNSFRSVYRCLWPSCRKVLTSSVGIKRHIRVMHLGISSGSDQSQRE
EDFYYTKICCETVEACSVPPPAQQALGQAFSSAHLSWAPCAPPPSSDLQMPPTPRPRSNS
SSGPGPSRLSPLSQSAPSSFWQIHSEHLYQSLKAFSYLGLCQFLKTKTKFKRTWACSPVQ
VSGVPRSPCSQAWPPSTSVSGNSSTQKKSRQTLNETPNDARLCRRKGRGEAKKCRKVYGV
ERKDQWCTACRWKKACQRFPD
Download sequence
Identical sequences H2MNG1
ENSORLP00000020264 ENSORLP00000020264 8090.ENSORLP00000020264

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]