SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000020272 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000020272
Domain Number 1 Region: 28-135
Classification Level Classification E-value
Superfamily SRCR-like 9.81e-37
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00029
Further Details:      
 
Domain Number 2 Region: 461-560
Classification Level Classification E-value
Superfamily SRCR-like 2.09e-32
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00022
Further Details:      
 
Domain Number 3 Region: 569-685
Classification Level Classification E-value
Superfamily SRCR-like 6.54e-27
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0014
Further Details:      
 
Domain Number 4 Region: 322-437
Classification Level Classification E-value
Superfamily SRCR-like 1.57e-18
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000020272   Gene: ENSORLG00000016197   Transcript: ENSORLT00000020273
Sequence length 904
Comment pep:novel chromosome:MEDAKA1:9:26618635:26653186:-1 gene:ENSORLG00000016197 transcript:ENSORLT00000020273 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FHSVQKLKHFLLLLEQYTPPVLDPDTPRIQLRLAGDKRKHNEGRVEVYYNGEWGTVCDDD
FNIHAAQVVCRELGYVEAVSWSPSSKYGKGEGTIWFDNLQCTGTEKTLALCRSNGIGVSD
CKHTEDVGVVCSDRRIPGFKFVNLLPNHVETNREKSNSKNPALFPQFLISAPLPLHISSN
RKHVHLCFYQNDCQYLKRITGTQFLMHKIFLCRIRYARNKTSKSATAALPEAQRNYPQHN
HTTAALALTSAQRKFKNRDSEPFGNSKSDYYQFQKSSSHLESMCDRFTWFCPKQFAQQNL
DIRVEDVRIRAILSSYRKRIPVTEGYVEVKDGGKWKQICDTEWTQFNSRVICGMFGFPGE
KRYNARVYNNRAWDRHRALPKNRLHVMMRKPTYWDFSVNCTGTEAHLSSCRLGHANSSDT
CTEGLPVVVSCVPGRAFAPTPMTGYRKAFRQEAPPTLQPLVRLRGGAIVGEGRVEVLKNG
EWGTICDDKWNLLAATVVCRELGFGTAKEALSGGRLGQGMGPVHMNEVQCSGFEKSITEC
LFNGEILGCSHEEDAAVRCNVPAMGFQQRLRLSGGRNPYEGRVEVLMERNDSLVWGTVCS
EGWGIMEAMVVCRQLGLGFASNAFQETWYWPGEVSADQVVMSGVRCSGTEMSLSHCLHHG
EHLSCPRGGGRKAAGVSCSETAPDLVLNPQVVEQTTYMEDRPMFMLQCAYEENCLSSTSG
QVPANTYRRLLRFSSQIHNNGQSDFRPKAGRHEWVWHECHSSRHYHSMEVFTTYDLFTLN
GSKVAEGHKASFCLEDSECDEGIEKKYECANFGEQGITVGCWDTYRHDIDCQWIDITDIK
PGDYLFQIVINPNYEVPETDYTNNITKCRCRYDGHRIWMYNCHNGGSLSAELEQTFPGLL
NNQV
Download sequence
Identical sequences H2MNG9
ENSORLP00000020272 ENSORLP00000020272 8090.ENSORLP00000020272

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]