SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000020408 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000020408
Domain Number 1 Region: 138-196
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000000437
Family Myb/SANT domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000020408   Gene: ENSORLG00000016303   Transcript: ENSORLT00000020409
Sequence length 249
Comment pep:novel chromosome:MEDAKA1:9:26954238:26956324:-1 gene:ENSORLG00000016303 transcript:ENSORLT00000020409 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AAEEETKSEQSSSRNQRLSSTKDDGIRLDLIRELEEFVPDVRNKSAHEIMKLVRYDLRRF
KDFKRQGVPLRCGRYTDWENRQIHKNIADFAALTDIGSAEQVLFPQRFKEQAAEIRRLKI
QHHFLQRIAEGIPRPCHQVYTRAKKIFDNRNHMGRFSEDELKSLKKLHQLHGNDWKTMSD
KMDRSVYALQKRFVCLAPVHGPWSKSEESRLKQAVRDHLETVFKESLKSGLTMDQLCNNL
PWKTISQKV
Download sequence
Identical sequences H2MNV0
ENSORLP00000020408 8090.ENSORLP00000020408 ENSORLP00000020408

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]