SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000020421 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000020421
Domain Number 1 Region: 393-443
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.68e-16
Family Classic zinc finger, C2H2 0.0078
Further Details:      
 
Domain Number 2 Region: 168-220
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000554
Family Classic zinc finger, C2H2 0.0085
Further Details:      
 
Domain Number 3 Region: 350-410
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000416
Family Classic zinc finger, C2H2 0.0061
Further Details:      
 
Domain Number 4 Region: 435-487
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000766
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 5 Region: 140-176
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000985
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Weak hits

Sequence:  ENSORLP00000020421
Domain Number - Region: 304-331
Classification Level Classification E-value
Superfamily Rubredoxin-like 0.0848
Family Rubredoxin 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000020421   Gene: ENSORLG00000016316   Transcript: ENSORLT00000020422
Sequence length 488
Comment pep:novel chromosome:MEDAKA1:24:13677255:13683464:-1 gene:ENSORLG00000016316 transcript:ENSORLT00000020422 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPRKKQQNPQPVKCMYSVVDSEDGVAIEAPGNLHLDTDLFLGHDLEFDAPDHDKILGLEK
FSXGWRIKGQALPSPSSLCASDSEKGGGLSLQSGVPGEARQLGCGQLRDELLGPGMDLVG
SYCLRCCKASSTSGEDKLCKQHSCHLCGFSSRYANHVKRHMKTHNGEKPFNCPLCTYASA
QLVNLQRHLRIHTGEKPYKCSSCSFACSSLGNLKRHQRMHVPSAGVGQDTSLRLDNPQTG
SKKPVDLQRPNGEASASEIDKPTSNLGLGAQNGDYLSAFDGLNSSSSATRGSVADEATIP
PSLFPFTCRLCGVVLEDEDGSSAQICAKCTLDMLTKDSSSSPNSPGERSDKVYTCSACPF
LTHYPNHLARHMKTHSGEKPYKCPQCDYASAHFDNLKRHHRVHTGEKPYKCHLCDYACGN
LANLKRHQRVHSGAKPFQCTLCSYNCNQSMNLKRHMLRHTGEKPYKCQECGYTTGHWDNY
KRHQKKHG
Download sequence
Identical sequences H2MNW3
ENSORLP00000020421 8090.ENSORLP00000020421 ENSORLP00000020421

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]