SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000020479 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSORLP00000020479
Domain Number - Region: 31-52,104-131
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00147
Family Classic zinc finger, C2H2 0.078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000020479   Gene: ENSORLG00000016358   Transcript: ENSORLT00000020480
Sequence length 160
Comment pep:novel chromosome:MEDAKA1:8:21976345:21978614:1 gene:ENSORLG00000016358 transcript:ENSORLT00000020480 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EVDVQHFLSHHILDEDDSDEDPEALKPVEKKCPYCPDRFHNGIGLANHVRGHLNRVGVSY
NVRHFISPEEVNAIEKKFSYQKKKKKVVLYQRRQKCSIANFDPDTFSVMHCEFCKAGFDT
RAGLSSHARAHLRDFGITNWDITISPIHILRELFSSRPDL
Download sequence
Identical sequences H2MP21
ENSORLP00000020479 ENSORLP00000020479 8090.ENSORLP00000020479

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]