SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000020584 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000020584
Domain Number 1 Region: 39-148
Classification Level Classification E-value
Superfamily SRCR-like 1.22e-42
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000020584   Gene: ENSORLG00000016441   Transcript: ENSORLT00000020585
Sequence length 158
Comment pep:novel chromosome:MEDAKA1:24:13980227:13981075:1 gene:ENSORLG00000016441 transcript:ENSORLT00000020585 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FGHSLLRGFISRCSNDVTSFSQCDLEEHVGTCDDATVDCTGNPSIRLVNGTDQCSGRVEI
LHDGQWGTVCDDEWDIRDAQVVCKEMNCGTALTVKRSAFFGQGQGEIWLDDVNCMGNETS
LLHCRRPSFGENNCGHGEDAGLVCSATIRLLNGTNQCS
Download sequence
Identical sequences H2MPC5
ENSORLP00000020584 8090.ENSORLP00000020584 ENSORLP00000020584

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]