SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000020593 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000020593
Domain Number 1 Region: 41-144
Classification Level Classification E-value
Superfamily SRCR-like 3.01e-44
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00012
Further Details:      
 
Domain Number 2 Region: 145-239
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000186
Family I set domains 0.016
Further Details:      
 
Weak hits

Sequence:  ENSORLP00000020593
Domain Number - Region: 6-39
Classification Level Classification E-value
Superfamily SRCR-like 0.000523
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000020593   Gene: ENSORLG00000016446   Transcript: ENSORLT00000020594
Sequence length 242
Comment pep:novel chromosome:MEDAKA1:24:13982179:13986533:1 gene:ENSORLG00000016446 transcript:ENSORLT00000020594 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEASGSCFDNVTSLKQCSLQGLRAAATCGHERDAGVSCAASLRLVGGSSQCSGRLEVFYK
GQWGTVCDDDWDMSSADVACKQIGCGHAVSAPTGAHFGRGSGPIWLDNVACTGEESAITH
CTHNGFGINNCGHGEDASVICLGSLQKPQITVHPGPEVIWGEKLEITCTVAPEHLGGMFV
LKNTQGTFVKEKFSDHEAAAFIFPSADFSLKGSYFCEYHKKLPNQIIYYPQGNTADISVT
GK
Download sequence
Identical sequences H2MPD4
ENSORLP00000020593 ENSORLP00000020593 8090.ENSORLP00000020593

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]