SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000020736 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000020736
Domain Number 1 Region: 518-571
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.79e-16
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 2 Region: 559-613
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000262
Family Classic zinc finger, C2H2 0.02
Further Details:      
 
Weak hits

Sequence:  ENSORLP00000020736
Domain Number - Region: 474-531
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000193
Family Classic zinc finger, C2H2 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000020736   Gene: ENSORLG00000016563   Transcript: ENSORLT00000020737
Sequence length 624
Comment pep:novel chromosome:MEDAKA1:8:22592401:22598838:1 gene:ENSORLG00000016563 transcript:ENSORLT00000020737 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASCLAEAPPDAILAGGESGSRRCRGRPRLTDSDRAQRRLESRKKYDVRRVYLGESHKLW
TELRRRTSLSDAGLAEYLILLDSTYGDQNQQKHCRKKSEAEVSGRGKKGRKPAVSRLSSL
VRWYQVHSQSCRHEPQLTALEVRPSCSATAVWRCDADHSFVQYLFSPPREASDSEEEGGS
DGEEMLEEDSAEQRNEKSDEELRETNICEESAARRTEEAAALERQPSPEASFGDPALTER
PVWGTAAPPSYPSEEAKDWRRSTEELKVDEEEIRSAECDYVPVPASVMDEFKGSGDSELP
QALNDSAPLDALLELSPPLQGQEQTGFLLIIITGPSYEALASEGIQLNVSSGNMEEVTCT
VIGSVSYNQAYFPSVFSTSQIQSFSKSIFSSAPDSYPIHCTVAQWLALLPHSKKAPGFKS
RLGVHLSNKNIQAEIQLFQIFFLTANTFISCTTDLGRSKRSRRGPVVEPDGMLKMFHCPY
EGCSQVYVAVSSFQNHVNLVHRKGRTKVCPHPGCGKKFYLSNHLHRHMIIHSGVRDFICE
TCGKSFKRKNHLEVHRRTHTGETPLQCEICGYQCRQRASLNWHMKKHTPEAHYNFTCEFC
DKRFEKLDSVKFHKLKSHPERQET
Download sequence
Identical sequences H2MPS3
ENSORLP00000020736 ENSORLP00000020736 8090.ENSORLP00000020736

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]