SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000020752 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000020752
Domain Number 1 Region: 483-599
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.0000000000342
Family Ankyrin repeat 0.0021
Further Details:      
 
Weak hits

Sequence:  ENSORLP00000020752
Domain Number - Region: 55-98
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0185
Family Classic zinc finger, C2H2 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000020752   Gene: ENSORLG00000016576   Transcript: ENSORLT00000020753
Sequence length 723
Comment pep:known chromosome:MEDAKA1:21:22199603:22203227:1 gene:ENSORLG00000016576 transcript:ENSORLT00000020753 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTASHSRSIFDLFSNEEAFELKEVNSVLLKEDGNPTAAPDCLQDNSREDDRRTENNLPR
EVSDKMLCSACKCPFNTKEEQREHYKLDWHRFNLRQKIVGLHPLNVEEFEKKTGSGDLSS
ISGSESDSEDEGSDTKGGVITDFTGTDCGSSISLHSITGRLSSKVVLQNSTGEYLLVYRC
VLQGKNDAVSSLRAINKGTVWVILMTGGGHFAGAVFEGPKVLQHKTFHRYTVRAKRGTAQ
GLRDSQNRSHTPKSAGAALRRYNEAALVKDIQDLMLTWAEHINKASVIFVRVPSYNRSIL
FGGRAAPLDKKDPRIRTIPFATRRATFREVQKVHELLSTVQVYGLDTDITVVLSPSKKTW
KSTVKSTVEESSDQKKGTTLFLTPEEEETNVSDEEEEAEIHLETVKLTLGTLDLRESEIF
PSRNKRRTKKRLKEETKNPNKGRTWRVSEATQAEESPQGTETLKEGKKEPQLDDVAEPLE
YGLKDALFTACKVGDVAALGRLLQSPEDRTESFEELKSKSSTIPSPLTLLNKPVDSSGFT
LLHVAAAAAQKEAVRLLLDSGADPACRDNKGQTPYIVSPDKDTRNFFRKYMGENPDKYDY
RKAQVPGPLTAETESKKAEKKKAQKAQKKQREKEQKEVKKKQEQEEEERRKFASLTDREK
RALAAERRLAEQAAAAGGSISNVKRCWSCGESLLEKIPFHYLEFAFCSPRCLQAHRKANV
PSA
Download sequence
Identical sequences H2MPT9
ENSORLP00000020752 8090.ENSORLP00000020752 ENSORLP00000020752

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]