SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000020784 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000020784
Domain Number 1 Region: 7-118
Classification Level Classification E-value
Superfamily POZ domain 2.06e-24
Family BTB/POZ domain 0.00078
Further Details:      
 
Domain Number 2 Region: 611-663
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000263
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 3 Region: 384-430
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000349
Family Classic zinc finger, C2H2 0.032
Further Details:      
 
Domain Number 4 Region: 508-561
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000139
Family Classic zinc finger, C2H2 0.04
Further Details:      
 
Domain Number 5 Region: 650-697
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000467
Family Classic zinc finger, C2H2 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000020784   Gene: ENSORLG00000016603   Transcript: ENSORLT00000020785
Sequence length 720
Comment pep:novel chromosome:MEDAKA1:7:26305673:26309301:1 gene:ENSORLG00000016603 transcript:ENSORLT00000020785 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AAMRIQLQGPGHAASVLAELNRCRQTRQYCDVFLQVGNRTFAAHRAVLACAGTYFQSLFT
RAAAASAVFSLEFVSPANFEKVLMFVYTGQVLIDLIDVGVLYELAERLGVGELVRACHAT
FPDLQASAVCSPAASCSSLSSSVGACTAPTPAAAPSPLFQSRASRQEAHADALTLEIKAE
DVQSHIGYEQQDHQLHGEHLLSTGNFSCQTDGVLPPGPVLQLKTEQILEDGATERCKEGD
QNTQMISASVSSIQNINPIPSDSCSLPDSSGQLGGEARPPTSSSEEQGGGLRVSSVGGGV
MDIQRDGRMMFDDGEREGSGEQTDPLPGEIIELSDDETEDDLVFVENGDVERSPLTCKAC
GAALLADPAAIRSHCETHLTELGLCKLCGASFSDSTAGVLHCLSHVGVQLFTCDMCRLQF
CSLNKLLRHRNHSACSYSIPQGALSQDPTAELKCGVCFKTLNKDFEVVREHTLSHVCPQS
LTCGVCHAPQLSLCSLLWHCLSHVSLPVFFCPHCALCFVERPLLDRHMSVHAEEAAAKEQ
CFLCPQTFRSPSALQNHLSLHTPDSLGGHSLLGKRMSFNMSEKFPQELLQGSSGVFTNGN
SGQEGGGARGKWYRCRFCGKRFAHSGEFTYHLRIHTGEKPYQCKVCLRFFRGRSTMICHL
KTHAGALMYRCTVCNLFFSTVKLVSSHMELHKDQLPPNFKIEETFMYNDHSKEPLHHIDS
Download sequence
Identical sequences H2MPX1
ENSORLP00000020784 8090.ENSORLP00000020784 ENSORLP00000020784

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]