SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000020797 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000020797
Domain Number 1 Region: 80-123
Classification Level Classification E-value
Superfamily Orange domain-like 0.000000000144
Family Hairy Orange domain 0.0062
Further Details:      
 
Domain Number 2 Region: 11-74
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.000000000537
Family HLH, helix-loop-helix DNA-binding domain 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000020797   Gene: ENSORLG00000016617   Transcript: ENSORLT00000020798
Sequence length 209
Comment pep:known chromosome:MEDAKA1:17:25685722:25688933:-1 gene:ENSORLG00000016617 transcript:ENSORLT00000020798 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRRPGADGGPADRKIMMMRKPLVEKRRRARINDSLHELRLLVADADLHAKMENAEVLEV
TVNRVESVMQNRDQDVDAVNREACERFAAGYIQCMHDVHTFMSSCPGIDQELSAELLNHL
LESLPLNEQNLVPDAASHHPGRNSTYAPHDRLQMAGVSPSPFASSTDDLSSDLDETDSEH
SQRSNSEEGRESHGTPHGVHFSKVLWRPW
Download sequence
Identical sequences Q1L7T7
NP_001098281.1.28442 8090.ENSORLP00000020797 ENSORLP00000020797 ENSORLP00000020797

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]