SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000020859 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000020859
Domain Number 1 Region: 11-220
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.96e-55
Family DBL homology domain (DH-domain) 0.00024
Further Details:      
 
Domain Number 2 Region: 209-330
Classification Level Classification E-value
Superfamily PH domain-like 3.85e-25
Family Pleckstrin-homology domain (PH domain) 0.014
Further Details:      
 
Domain Number 3 Region: 382-558
Classification Level Classification E-value
Superfamily PH domain-like 1.23e-23
Family Pleckstrin-homology domain (PH domain) 0.0000363
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000020859   Gene: ENSORLG00000016673   Transcript: ENSORLT00000020860
Sequence length 561
Comment pep:novel chromosome:MEDAKA1:23:20876638:20892409:1 gene:ENSORLG00000016673 transcript:ENSORLT00000020860 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FLIFQQEDEMKRKKVVHIAQEIMSSEKVFVDVLKLLHIDFRDAVAKATRQNGKPVVDERI
LNQILYYLPQLYQLNKDLLRELEERVGHWSDHQRLADIFVQKGPYLKMYSTYIRQFDNNV
ALLDEQCRKNLGFAAVVREFEMSPRCASLALKHYLLKPVQRIPQYQLLLTDYLKNLPEDS
EDYKDTQTALSIVKEVANHANDIMKQGDNFQKLMQIQYSLNGHHEIVQPGRVFLKEGTLM
KLSRKVMQPRMFFLFNDALMYTTPVQSGQYKLNSVLSLAGMKVSKPSQEAYQNELNIESV
ERSFILSASSATERDEWLEAIAKAIDDYTKKKITFISSRSQEEAEVFVDNGAPLGSKAPI
WIPDLRATMCMICTCEFTLTWRRHHCRACGKVVCQACSTNKYYLEYLKNQPARVCDHCFA
KLKENSDRCASTSVSPIKSGAFSFTRKQKKIPAALKEVSANTENSSMSGYLYRSKGNKKQ
WKRLWFVIKNKVLYTYAASEDVAALESQPLLGFFLREEKNGPAQKLQFKLYHKNTLFYMF
KADDIPTAQRWIEAFQEAMIL
Download sequence
Identical sequences H2MQ45
ENSORLP00000020859 8090.ENSORLP00000020859 ENSORLP00000020859

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]