SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000021033 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000021033
Domain Number 1 Region: 26-134
Classification Level Classification E-value
Superfamily SRCR-like 8.5e-38
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00021
Further Details:      
 
Domain Number 2 Region: 310-409
Classification Level Classification E-value
Superfamily SRCR-like 1.57e-34
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00022
Further Details:      
 
Domain Number 3 Region: 419-529
Classification Level Classification E-value
Superfamily SRCR-like 1.01e-25
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0018
Further Details:      
 
Domain Number 4 Region: 173-292
Classification Level Classification E-value
Superfamily SRCR-like 1.23e-18
Family Scavenger receptor cysteine-rich (SRCR) domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000021033   Gene: ENSORLG00000016809   Transcript: ENSORLT00000021034
Sequence length 755
Comment pep:novel chromosome:MEDAKA1:5:31569310:31597179:1 gene:ENSORLG00000016809 transcript:ENSORLT00000021034 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LFFKMAAFCLLCILVLRGARSNSAPPVIQLRLAGEKRKHYEGRVEVLYNGEWGTVCDDDF
SLYAAHVVCRELGYMDAQAWYPSAKYGKGEGRIWLDNVHCSGSEKSLAQCESNGFGVSDC
KHSEDVGVVCSTKRIPGFKKLTEKTANAPKPQQQKVEDVRIRATYSHRKRVPITEGFVEV
KDGGKWRQICSEDWTEMNSRVICGMYGFPGVKRFNVRPYNTNRTQASKRKAPAARLLAQR
RKKNYWGFGVNCTGNEADLSDCKLGREIKLKGNSTCGRGMPTVISCVPGRAFAPSVSIGF
RKAYRVEQPLVRLRGGAMLGEGRVEVLRNGEWGTVCDDNWNIRAATVVCRELGFGSAKEA
LSGAKMGQGIGPVHMNEVECSGFEKSLTECSFNLESLGCSHEEDAAVKCNIPAMGFNKKL
RLSGGRNPYEGRVEVLAERNGLLTWGSVCSDSWGTMEAMVVCRQLGLGFASHAFQETWYW
QGDSSSDVVVMSGVRCSGTELTLDQCLHHGSHIDCPKGGGRFAAGVSCTLTAPDLVLNAP
VVEQTTYLEDRPLYALQCAMEENCLSSAASKADPTSYRRLLRFSSQIHNNGLSDFQPRAA
HHSWTWHECHRHYHSMEVFTHYDLLSLNGTKVAEGHKASFCLEDTQCDEGIQKRYECANF
GSQGITVGCWDTYRHDIDCQWVDITDVKPGDYIFQVVINPNYEVAESDYTNNVMKCQTRY
DGHRIWTYNCHIGETFKMVVEIKWDEKVTSQSTIV
Download sequence
Identical sequences H2MQL2
ENSORLP00000021033 8090.ENSORLP00000021033 ENSORLP00000021033

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]