SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000021204 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000021204
Domain Number 1 Region: 183-239
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000912
Family Classic zinc finger, C2H2 0.0063
Further Details:      
 
Domain Number 2 Region: 145-196
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000212
Family Classic zinc finger, C2H2 0.0088
Further Details:      
 
Domain Number 3 Region: 976-1027
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000181
Family Classic zinc finger, C2H2 0.017
Further Details:      
 
Domain Number 4 Region: 666-718
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000337
Family Classic zinc finger, C2H2 0.026
Further Details:      
 
Domain Number 5 Region: 839-864,927-952
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000575
Family Classic zinc finger, C2H2 0.041
Further Details:      
 
Domain Number 6 Region: 725-773
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000119
Family Classic zinc finger, C2H2 0.028
Further Details:      
 
Domain Number 7 Region: 813-851
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000133
Family Classic zinc finger, C2H2 0.033
Further Details:      
 
Weak hits

Sequence:  ENSORLP00000021204
Domain Number - Region: 1282-1332
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000114
Family Classic zinc finger, C2H2 0.044
Further Details:      
 
Domain Number - Region: 1250-1292
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000247
Family Classic zinc finger, C2H2 0.041
Further Details:      
 
Domain Number - Region: 768-824
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000803
Family Classic zinc finger, C2H2 0.024
Further Details:      
 
Domain Number - Region: 512-567
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00111
Family Classic zinc finger, C2H2 0.065
Further Details:      
 
Domain Number - Region: 1173-1216
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00795
Family Classic zinc finger, C2H2 0.032
Further Details:      
 
Domain Number - Region: 313-365
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00833
Family Plant C2H2 finger (QALGGH zinc finger) 0.085
Further Details:      
 
Domain Number - Region: 439-491
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0197
Family Classic zinc finger, C2H2 0.058
Further Details:      
 
Domain Number - Region: 71-99
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0261
Family Classic zinc finger, C2H2 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000021204   Gene: ENSORLG00000016949   Transcript: ENSORLT00000021205
Sequence length 1369
Comment pep:novel chromosome:MEDAKA1:17:26343923:26430600:-1 gene:ENSORLG00000016949 transcript:ENSORLT00000021205 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FLSDYVQSESLRGRGPLWSHPDGFGGLASIFHYYVDYRSDSAVQDLADPESALERATEDG
EVGRLRKGLLSPALHSCDSCRQVFESLSDLTEHKINQCQLTGVADLEDDPSCSWPASSPS
SKDQTSPGHCEDYDFGEDEGGPGLPYPCQFCDKSFSRLSFLKRHEQSHGDKLPFSCTFCS
RLFKHKRSRDRHVKLHTGDKKYHCGECDSAFSRSDHLKIHMKTHASNKPHKCPVCRRGFL
SSSSLHGHMQVHERGKDGSSSSFSRGEDWKLKETRKCSRCEEGFDVPEELQRHIAECHPD
CSPSEDGGLGATLQCIYCHEPFSDEGTLLTHIDQAHSRDRKGHICAICSEHFLSVEDLYA
HMDIHQLPESSNHSNSPSLLTVGYTSVSSTTPDSNLSVDSSTMVETAPPVPKTRGRRKRA
AQNTSDIGGRSSKQPKVSYSCIYCNKQVFSSLAVLQIHLRTMHMDKPEQAHTCQFCLEVL
PSLLNLNEHLKQIHNAEDHAALLASLPDALLQCNFCPEVLSDLNALQEHIRCSHGFPSPV
AKESNAFFCPQCFMGFLTEATLEEHVRQTHCDGGSLRFDSPLAVTPKEPIVEVYSCSYCT
NSPIFNSVLKLNKHIKENHKNIPLALNYINNGKKSLRTLSPSSPISVEQTTILKQGSSAS
RTTSEFICNQCGAKYTSLDLFQTHLKTHLDGLQPQLTCPQCNKEFPNQESLLKHVTIHFT
ITSTYYICESCDKQFTSVDDLQKHLLDMHTFVFFRCTLCQEVFDSKVSTQLHLAVKHSNE
KKVYRCTSCNWDFRHETDLQLHVKHSHLENQGRAHRCIFCGESFGTEVELQCHITTHSKK
YNCRFCSKAFHAIVLLEKHLREKHCVFEGKTQNCSANGSTVNSGEGQPKEDAELQGLLTN
SHGSGAAGGSVVESQNSHDGSEEEVDSAEPMYGCDICGASYTMESLLTNHQLRDHNIRPG
ESAMIKRKAEMIKGNHKCNVCSRTFFSEAGLREHMQTHLGPVKHYMCPICGERFPSLLTL
TEHKVTHSKSLDTGSCRICKMPLQSEEDFLEHCQMHPDLRNSLTGFRCVVCMQTVTSTLE
LKIHGTFHMQKTGTINALSQNQQHHLAQKFFKCASCLKDFRSKQDLVKLDINGLPYGLCA
SCVTAAGSTSSSPTVNGGRPQQHGGATTPATNTVAWVQGDSLSPGDGKGKAVSSKTRCSS
CNVKFESEAELQNHVQTVHREQSADSNSGQLKTPQVSPMPRSSPSQAEEKKTYQCIKCQM
VFYSEWDIQVHVANHMLEEGLNHECKLCSQSFDSPAKLQCHLIEHSFEGMGGTFKCPVCF
TVFVQANKLQQHIFSAHGQEDKIYDCSQCPQKFFFQTELQYFTVVVFSS
Download sequence
Identical sequences H2MR28
ENSORLP00000021204 8090.ENSORLP00000021204 ENSORLP00000021204

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]