SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000021243 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000021243
Domain Number 1 Region: 334-387
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.69e-20
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 2 Region: 52-108
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.64e-18
Family Classic zinc finger, C2H2 0.0084
Further Details:      
 
Domain Number 3 Region: 108-164
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.02e-16
Family Classic zinc finger, C2H2 0.0089
Further Details:      
 
Domain Number 4 Region: 372-424
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.82e-16
Family Classic zinc finger, C2H2 0.0073
Further Details:      
 
Domain Number 5 Region: 15-65
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000431
Family Classic zinc finger, C2H2 0.0065
Further Details:      
 
Domain Number 6 Region: 149-201
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000495
Family Classic zinc finger, C2H2 0.022
Further Details:      
 
Domain Number 7 Region: 414-467
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000012
Family Classic zinc finger, C2H2 0.029
Further Details:      
 
Domain Number 8 Region: 237-285
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000189
Family Classic zinc finger, C2H2 0.02
Further Details:      
 
Domain Number 9 Region: 275-329
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000852
Family Classic zinc finger, C2H2 0.098
Further Details:      
 
Weak hits

Sequence:  ENSORLP00000021243
Domain Number - Region: 183-234
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00345
Family Classic zinc finger, C2H2 0.029
Further Details:      
 
Domain Number - Region: 459-484
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0137
Family Classic zinc finger, C2H2 0.08
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000021243   Gene: ENSORLG00000016981   Transcript: ENSORLT00000021244
Sequence length 493
Comment pep:novel chromosome:MEDAKA1:16:29896101:29899131:-1 gene:ENSORLG00000016981 transcript:ENSORLT00000021244 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AVPDARHDSAEKPRHRCSECGQEFSRPSRLADHVASHSGVKRHSCSICGKRFTKKFNLRI
HQRVHTGEKPYSCPDCSASFAQQGCLRRHRLQHAAKKPHLCSECGRGFTQRRYLVQHERT
HTGEKPFSCLLCPKRFASRNGLVDHHKTHAEQKLFSCSLCQKAFSSASSFRDHVRLHTGQ
KLHPCSLCSRSFNRPSKLRGHLQRHADEAAGACFLCQEDFSSIEQLQEHRRLQHPAPRFA
CSVCGRTFTRTTRLKVHMKSHSMQHLLRCSTCSKTFSRPGSLRAHQRSHQAQTLHACSIC
SRGFRKPCLLRKHMRSHRRSKHLCPVCGRDCFKASALQKHLRIHSGERPYQCPTCSKSFV
QQVHMKEHQRIHTGEKPFTCPQCAKSFTFSSALRRHQRLHDDARPFCCHVCKKSFKQRSV
LKSHLLTHSGVRYQCPLCSRSFSRALELTYHVDVHSEARPYFCSICNLDLSGARIFRNHM
RKHESAGRPAGSE
Download sequence
Identical sequences H2MR64
8090.ENSORLP00000021243 ENSORLP00000021243 ENSORLP00000021243

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]