SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000021273 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000021273
Domain Number 1 Region: 122-195,249-413
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.94e-19
Family Eukaryotic proteases 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000021273   Gene: ENSORLG00000017005   Transcript: ENSORLT00000021274
Sequence length 432
Comment pep:novel chromosome:MEDAKA1:24:15553986:15556826:-1 gene:ENSORLG00000017005 transcript:ENSORLT00000021274 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFPFPLTLKVQFLRKNQISAPTVRLPKKKQKLPKLLLTQTKHLSTPLFKGRQANESSGGS
EVFCGIECQSTLPPLDQTTQERILGYETLHESGTCTHTDVSLQWIKTTFAQPMTPLPAHT
RKKRQVYGEDGRFVISDSQFITTYPFSTAVRISAGCSGVLVSPKHVLTAAHCIHDGMDYL
EGARKLKVGLLKLKKKRGKRKRRGGRRRYGKHVESMRVELNGKNKHFEKIKRRRDESRSH
RGRKRAGRSRLQPVFRWTPIEKIHIPQGWIHTNSSPVFVFSDYDYALLELKRPVKQKHME
LGVAPSSASLGRIHFSSHDIDKSLLDGFGEKNVVYRFCSVTKESDDLIYQHCDAQLGATG
AGIYIRLRQEEDGNGRKAKWQRRVIGVFSGHRWVQVEEGKNRDYNVAVRITPLKYAQICL
WIHGDSSFCQNI
Download sequence
Identical sequences H2MR94
ENSORLP00000021273 ENSORLP00000021273 8090.ENSORLP00000021273

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]