SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000021275 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000021275
Domain Number 1 Region: 17-135
Classification Level Classification E-value
Superfamily POZ domain 1.26e-29
Family BTB/POZ domain 0.0012
Further Details:      
 
Domain Number 2 Region: 431-483
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.1e-17
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 3 Region: 410-440
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000104
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Weak hits

Sequence:  ENSORLP00000021275
Domain Number - Region: 365-395
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000331
Family Classic zinc finger, C2H2 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000021275   Gene: ENSORLG00000017008   Transcript: ENSORLT00000021276
Sequence length 497
Comment pep:novel chromosome:MEDAKA1:22:14317870:14320615:-1 gene:ENSORLG00000017008 transcript:ENSORLT00000021276 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QPAFPGSDRSSSYEGRMEFPDHSRQLLQCLSQQRHQGFLCDCTVLVGEARFKAHRAVLAS
CSMYFHLFYRDQPDKRDVVHLNSDIVTAPAFSLLLEFMYEGKLEFSTLPVEDVLAAASYL
HMYDIVKVCKGKLKDKELSSLDEKMGEGLGLGCLDRENSSDGELHKEFDIDNSEVRLAVT
DCDRSTQSRQQANGHSGRSPDLVGVNYVSAEAEPCVQTAGKTKADVSSSTVLLSQRSRAS
DDMDCALDLSFKPLSSRDPLHPSYVSGQLALDSQQQGTEPLVKDEHDLLSEQEDSEPMSP
ESQRYGNSARSSVVTGFAALFQGNNGATAALLSQEEDLMDSEEEEEDDLASSDISTSSGV
LLPPGQQVCVCPLCSKCFPSPHVLQLHLSSHFREKDGARSKLSPDGSVPTCIQCNKTFSC
MYTLKRHERTHSGEKPYTCGQCGKSFQYSHNLSRHAVVHTREKPHACKWCERRFTQSGDL
YRHIRKFHCGLVKTLAI
Download sequence
Identical sequences H2MR96
8090.ENSORLP00000021275 ENSORLP00000021275 ENSORLP00000021275

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]