SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000021447 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000021447
Domain Number 1 Region: 26-67
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000387
Family Classic zinc finger, C2H2 0.07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000021447   Gene: ENSORLG00000017143   Transcript: ENSORLT00000021448
Sequence length 393
Comment pep:novel chromosome:MEDAKA1:23:22751769:22754767:1 gene:ENSORLG00000017143 transcript:ENSORLT00000021448 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGKAEFLTPKSISNRIKAKGLQKLRWYCQMCQKQCRDENGFKCHCMSESHQRQLLLASEN
PTKFMDYFSDEFKRDFLELLRRRFGTKRVHNNIVYNEYISYREHVHMNSTQWETLTDFTK
WLGREGLCKVDETPKGWYIQYIDRDPETIRRQEELARKKKQEMDDVERSAKFIEEQVRRG
RDGKETEETPVFTELKRESEEEKVVFNLGASACVAGPSKPSLSSVLGPSALKAAAAPPSV
KRKDPPSSSDSKSEKKKKSALEEIIEMEERKKKQPSRTDYWLQPDIVVKVITKKLGEKYH
KKKAVVTEVRDRYGAVVKLIDSGDKLKLDQNHLETVIPAPGKRVLILNGPYRDTEALLEG
IDEKNFSATLTLDAGHLKGKRVTVAYEDFSKLA
Download sequence
Identical sequences H2MRR5
ENSORLP00000021447 ENSORLP00000021447 8090.ENSORLP00000021447

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]