SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000021464 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000021464
Domain Number 1 Region: 195-412
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 4.71e-51
Family DBL homology domain (DH-domain) 0.00016
Further Details:      
 
Domain Number 2 Region: 717-974
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.0000000000000751
Family WD40-repeat 0.022
Further Details:      
 
Domain Number 3 Region: 424-508,599-655
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000154
Family Pleckstrin-homology domain (PH domain) 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000021464   Gene: ENSORLG00000017150   Transcript: ENSORLT00000021465
Sequence length 1167
Comment pep:novel chromosome:MEDAKA1:5:32970658:33117693:-1 gene:ENSORLG00000017150 transcript:ENSORLT00000021465 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AWRRNGGQSLQRGLLPALSESGAAAQTSEVIYDDVPCEDAPAPAEADMIYEDVQRDNGAL
EPDNGWSSSEFESYDEHSDNEAKPPARSKPPLHAFPCVFPLCTCGGRRARKRSNQEALRH
SNAPLLFLCAPPDQVQQLMKAARSGTKDGLERTKIAVMRKVPFLQRRDQIDTAEEEDDAG
YLDVVVSEGKHPPPQLSPMPEGLTSHQVVRRHILGSIIQSERSYLESLRRISQEYHRPLM
EADPRILSQRKIRPIFFRVREITQCHSMFQIALASRVAEWDSNEKIGDLFVASFSKSMVL
DVYSDYVNNFTNAMALIKKACMSKPAFLEFLKKKQVSSVDRITLYGLMVKPIQRFPQFIL
LLQDMLKNTPKGHVDRLPLQLALTELEMLAEKLNEQKRIADQIAETHQLARSVSDRLLSK
QLSSEQGSLVLCETLVETVYGERGQVLKSKERKVFLFDDVLVCANINALSSGSRGPPDIS
SLVPVGPKYTMKWSAPLQQVQVVEVGQEGSQSKDASFQQSGARRPSAACASGKTLLGPPR
LYQELQELQHDLSVVEEVTLLVGTLQGTYQNLNTTVAQDWCLALQRLIRIKEEQIQCANK
CRLRLQVPGRPDKSGRPVSFMVVFNTPNPLSKISWVNRLHLAKIALRGENSPGWLYGEDE
GKTIASFSSPLLVCHMPVFATKSAERKLETALHSPAHCSLLGFSAASTSLPQGYFWVVGG
GEDSQGHIEIFSLNRPAPRAVKSLQVGSAVRCLEFVPAPSRSEDLEAGGQRAASASAANI
CVGLDDGRILVYGSLDTAAQCLLTLHNPEGCPVLCLKHSSGALFAGLQSGVVIVYGRNQN
EDLWDSDSHRCISLGSEPVRTMLVLDDVVWASCGNSVITIDVSSLATQQKSEVHSDPAVS
VAHMACAGGGVWMAFSEGSSIRLFHTETLELLQEINISTRSSLLNAGQKNTRVTSLLICQ
GLLWVGTAQGAIITLPVPKLEGIPKITGKGMISVNAHCGPVDFLVATSSTLSPELLKRDS
FGESPDSACGGEERSSDTSSQESLQRSYQGEEKGKGRGVLLQYKLRSTSGLPGWPLTGQS
DGASQSSLESLEHSEDGSIYGLSDDPDTWVRGRSCERDGARRDRVTSAAVISGGKGFRRL
KGGATGTRTGGDCLENILMVWQLPLTV
Download sequence
Identical sequences H2MRT1
ENSORLP00000021464 ENSORLP00000021464 8090.ENSORLP00000021464

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]