SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000021576 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000021576
Domain Number 1 Region: 202-264
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000022
Family HkH motif-containing C2H2 finger 0.044
Further Details:      
 
Domain Number 2 Region: 457-514
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000254
Family HkH motif-containing C2H2 finger 0.075
Further Details:      
 
Domain Number 3 Region: 274-310
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000143
Family Classic zinc finger, C2H2 0.065
Further Details:      
 
Weak hits

Sequence:  ENSORLP00000021576
Domain Number - Region: 51-214,321-354
Classification Level Classification E-value
Superfamily Phase 1 flagellin 0.00523
Family Phase 1 flagellin 0.043
Further Details:      
 
Domain Number - Region: 674-736
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 0.0916
Family 2'-5'-oligoadenylate synthetase 1, OAS1, N-terminal domain 0.072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000021576   Gene: ENSORLG00000017243   Transcript: ENSORLT00000021577
Sequence length 967
Comment pep:novel chromosome:MEDAKA1:9:30421894:30437905:-1 gene:ENSORLG00000017243 transcript:ENSORLT00000021577 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AVAAAATAAAYGGYQPAHAATDYTYTQRQPEVPPPPPPVTSQNYQDSYSYVRSSATAMSY
DSKQYYQQPTATAAVAAAQPQPSVADSYYQTAPKPGYSQGVTSYTQTQQTRQVTVIKPAA
PSPASSTFSIYPVTSTVQPVAAAAASVVPTYSQSPTYSTNAVTYSGTSYSGYEAAVYSAA
SNYYQQQQQQKQAVAAVAATAAWSGSPFAKKPAFQNKQLRPKQPPKPPQIHYCDVCKISC
AGPQTYKEHLEGQKHKKKEAALKVSQSSSSTGGGAMARSAQNQLRCELCDVSCTGADAYA
AHIRGAKHQKLGKPIPSTEPSIVTQTSSSVTSASSKTTTAVLGGSSSALSASASCSSAAS
LSSSYMKPASAVSGSAAGVKNPLGHGPPAAGYAAAAAKKICTPKINFVGGNKLQTTAKAE
ESRSEVKVDTCKPVAPPSGCLDKADVCDALSPSALVALQSDVQPVGHDYVEEVRNDEGKV
IRFHCKLCECSFNDPNAKEMHLKGRRHRLQYKKKVNPDLQVEVKPSIRARKIQEEKMRKQ
MQKEEYWRRREEEERWRMEMRRYEEDMYWRRMEEEQHHWDDRRRLPDGGYPQGPPGLLGV
RPGMPGLQPQGPMPPRRPDSSDDRYVMTKHAAIYPSEDELQSIQKIVSITERALKLVSDI
ITEQEGVQEEDKEAQAKDRALKGVMRVGVLAKGLLLRGDKDVNLVLLCSEKPTKTLLSSI
LEHLPKQLTVVTPEKYEVKGSIQEAAIILTSCSDPKMQVTITLTSPVIREEAGREGDVTS
GLVKDPADVLDRQKCLDALAALRHAKWFQARANGLQSCVIIIRILRDLCQRVSTWSPFPR
WAMELLVEKAISSASAPLSPGDALRRVFECIASGILLPGGPGLMDPCEKKPVDTLSSLGE
QQREDITSSAQFALRLLAFRQIHKVLGMDPLPQINPRFNSRKRRRDNSDGTDSFEGEGKK
DKKDYES
Download sequence
Identical sequences H2MS41
8090.ENSORLP00000021576 ENSORLP00000021576 ENSORLP00000021576

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]