SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000021585 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000021585
Domain Number 1 Region: 279-323
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.14e-16
Family Classic zinc finger, C2H2 0.0021
Further Details:      
 
Domain Number 2 Region: 312-351
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000289
Family Classic zinc finger, C2H2 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000021585   Gene: ENSORLG00000017252   Transcript: ENSORLT00000021586
Sequence length 370
Comment pep:novel chromosome:MEDAKA1:21:23927876:23929335:1 gene:ENSORLG00000017252 transcript:ENSORLT00000021586 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAVAVLRNETLQAFLQDRTPNSSPENCKHSPLALLAATCNRIGHHHGSNPTEFLQVPYD
PTLGSPSRLFHPWTNEGNPPSSSTFGLSSKPQLSAHIQSSFSSPHELPLTPPADPSYPYD
FSPVKMLPCSMQSLQSTCPPTYVPAVSYAAPTPIPPAMPSFVTGPSGLVHQQQRQLSPNP
GEDIPWWSLQQGNHVSHTSSLAPHRFQLQRGLVLGHTDFAQYQTQIAALLHTKSPLATAR
RCRRCRCPNCQSSTSSDEPGKKKQHICHIPGCGKVYGKTSHLKAHLRWHSGERPFVCNWL
FCGKSFTRSDELQRHLRTHTGEKRFVCPDCCKRFMRSDHLAKHVKTHQNKRSKCQEKTLD
HVKREDTRTH
Download sequence
Identical sequences H2MS50
8090.ENSORLP00000021585 ENSORLP00000021585 ENSORLP00000021585

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]