SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000021679 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000021679
Domain Number 1 Region: 49-84
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000104
Family HkH motif-containing C2H2 finger 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000021679   Gene: ENSORLG00000017334   Transcript: ENSORLT00000021680
Sequence length 328
Comment pep:novel chromosome:MEDAKA1:17:27856901:27857887:-1 gene:ENSORLG00000017334 transcript:ENSORLT00000021680 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QQTLMMATSKKGKKVVNQEELRRLMREKQRQTADKKRVESPFAKYNSLGHLSCTLCSVQV
KSDLLWPAHVLGKQHKDNVAELKGAKTTPAPSQTPKRKAPDTEAVTAKKAKPASVASQST
SDASEKPLTTQQSAGLSLLAGVYDDEDANAESEAPAQGADGGLPADFFDSSIPSTPAISH
SGSVLKAETKEKPPEKKENTSEVLPEGFFDDPVRDAKVRNVDAPKDHMDKEWEEFQKEIR
QVNTKSEAIVAEDDEEGRLERQIDEIDEQIECYKRVELLRDKRDAVKSKALPKKDKPKEI
QEDVDDEDDEEELLGLLTQDWRAKGALA
Download sequence
Identical sequences H2MSE1
8090.ENSORLP00000021679 ENSORLP00000021679 ENSORLP00000021679

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]