SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000021762 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000021762
Domain Number 1 Region: 108-300
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 8.11e-51
Family DBL homology domain (DH-domain) 0.0000755
Further Details:      
 
Domain Number 2 Region: 310-437
Classification Level Classification E-value
Superfamily PH domain-like 4.81e-16
Family Pleckstrin-homology domain (PH domain) 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000021762   Gene: ENSORLG00000017402   Transcript: ENSORLT00000021763
Sequence length 440
Comment pep:novel chromosome:MEDAKA1:5:33648388:33662140:1 gene:ENSORLG00000017402 transcript:ENSORLT00000021763 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KKRKQINRDADSLSLCSLDINEPSSKRSKPVSRVASLASLLPPVKSTPLKRIGLRLQVIP
AAISDSSSSVTASRVSTATAQPSKRRDSKLWSETFDVRTGATQTLSPFSLLKAIFELAQG
EQDLVEDLKLAKKAYHDPMLKLSIMTEQELNQIFGTLESLIPLHEDLLGRLRDARKPDGS
TEHVGHILTAWLPCLSSYTSYCSNQVKAKALLDQKKQDRRVQDFLQRCLQSPFSRKLDLW
NFLDIPRSRLVKYPLLLREILKHTAIDHPDRQHLDEAMLMVQSVVADINRQTGESECQYY
KERLLYSEEGQRDQLIDRSKTLCCHGELKNNRSVKLHVFLFQNILVITRSVSLHNQPVSY
QLCRQPIPLTRLDLEDLSDGEMRVGGSIRGAFSNTERTKNFFRVSYRAEGQPLTHSFQAS
DAFNKQQWINCIRQAKEAAV
Download sequence
Identical sequences H2MSM2
ENSORLP00000021762 ENSORLP00000021762 8090.ENSORLP00000021762

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]