SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000021804 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000021804
Domain Number 1 Region: 212-272
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000122
Family HkH motif-containing C2H2 finger 0.046
Further Details:      
 
Domain Number 2 Region: 412-467
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000159
Family HkH motif-containing C2H2 finger 0.062
Further Details:      
 
Domain Number 3 Region: 281-319
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000102
Family C2HC finger 0.094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000021804   Gene: ENSORLG00000017438   Transcript: ENSORLT00000021805
Sequence length 913
Comment pep:novel chromosome:MEDAKA1:4:34411291:34435579:-1 gene:ENSORLG00000017438 transcript:ENSORLT00000021805 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TASYSPASVQAARPVASSPYPTYQSHQAPPDFTYRQPDPPQPTTTPQTYQENYNYGRPAA
VTTYDNKQYYQTSIASAQRAHTENYYQSGVKSAYSPASSTIYNQPPPTQRQVAALKPLVP
SSSVSTTYNVYPVATSVQQPPAPISSYTLGSTFSSSAAATSYSGLNYSSYDSAGYTSAST
PSYYQPAQQTLPQGPPPQSQQPQPNMVTAPAGNAYKKPAFHQNKLQRPKGPPKQSQLHYC
DICKISCAGPQTYREHNEGQKHKKKEAALKAGAQSGASNGPRGVQTQLRCELCDVSCTGV
DAYAAHIRGAKHQKVVKLHTKLGKPIPSSEPVLVNSAPILASSSAGKPPASPASSSPSTA
AAPAAKLKQTAGNPPAKAPVGARAVTSAAEEPVLPPVPKLKPQSEDEGAGGQGDIQPVGH
DYVEEVRNDDGKVIRFHCKLCECSFNDPNAKDMHLKGRRHRLQYKKKVNPELPVEIKPSN
RARKLQESKLKKLKQKAVLKRQRDDEQHWHLEMRRLEEEQMYWGDQRRRIAPPPLMSRPG
MPVPPLLTCVRRPDSSDDRHIMAKHSTIYPVEEELQAVQRIVSHTERALKLVSDSLLEKE
VPAPASTSEDGEEKSADSAARLLKGVMRVGILAKGLLLRGDRNVELILLTAKKPTVTLLK
TVAKQLPKELEIFSEDQYEVQARPEEANIVIISSKEPQMQVTISLTSPLMREDPAAETDK
QAGGKAAEKDPPDLLSKKKCLENLAALRHAKWFQARANGLQSCVIIIRVLRDLCQRVPTW
GKVPSWALELLVEKAISSAAGPLSPGEAMRRVLECISTGVLLPDAPGLLDPCEKEQTDAL
KGVNLQAREDITASAQHALRLLAFRQIHKVLGMESLPASKASARNRKRRRDVGEAGEGEG
EGKKDKKEEATSA
Download sequence
Identical sequences H2MSR1
8090.ENSORLP00000021804 ENSORLP00000021804 ENSORLP00000021804

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]