SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000021848 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000021848
Domain Number 1 Region: 498-542
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000337
Family Classic zinc finger, C2H2 0.0014
Further Details:      
 
Domain Number 2 Region: 531-570
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000418
Family Classic zinc finger, C2H2 0.0019
Further Details:      
 
Weak hits

Sequence:  ENSORLP00000021848
Domain Number - Region: 124-198,249-302
Classification Level Classification E-value
Superfamily Phase 1 flagellin 0.000327
Family Phase 1 flagellin 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000021848   Gene: ENSORLG00000017474   Transcript: ENSORLT00000021849
Sequence length 636
Comment pep:novel chromosome:MEDAKA1:21:24265868:24273060:-1 gene:ENSORLG00000017474 transcript:ENSORLT00000021849 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SDPSAQLTGTDRWQVVTPTTTAKDDSGIIQIQSQGILTSNGQYVLPLQNLQSQPIFVTSG
RDASSANSVPNIQYQVIPQIQTADGQLSFSASSVEAQSLTQDATGQIQILTDGSQSLGVA
TSASILNNNQNLLSQTGNVQQIQGVSVGSSTFTNQGHVVTSVPVGLPGNITFLPINSVDL
DSLGLSGAQTIATGVTADGQLIMASQPAESSESLAKPEDHLSQTLPASDSNANSEMFGSS
SSSQLHASANENDLLTQDSSAGQTDSSAAIEESYAQQNQEQSVQVSSAQPVLQLQQVPLQ
TTNGQVVQSIASAGGQNLQNVQLINPGTFIIQAQTVTPSGQIQWQTFQVQGVQNLQNLQL
PTTPPQQITLAPMQTLSLGNISAGQIPNLQTVTVNSMGQQEGNQGAAADLFSDIQIKEEP
DSRDWLGTDSTLNPSDLSNLHARLVDDDDQLGQEGKRLRRVACTCPNCKDSGGRGSGTGK
KKQHICHIVGCGKVYGKTSHLRAHLRWHSGERPFVCSWMFCGKRFTRSDELQRHRRTHTG
EKKFVCPECSKRFMRSDHLAKHIKTHQNKKGVNSGGAVVASMESAGSSDSIITTAGGTTL
ILANIQQSSNNAQDILANAEIPLQLVTKVSASEVME
Download sequence
Identical sequences H2MSV5
ENSORLP00000021848 8090.ENSORLP00000021848 ENSORLP00000021848

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]