SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000021967 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000021967
Domain Number 1 Region: 270-319
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000341
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 2 Region: 87-214
Classification Level Classification E-value
Superfamily SET domain 0.000000000000474
Family Histone lysine methyltransferases 0.028
Further Details:      
 
Domain Number 3 Region: 235-282
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000293
Family Classic zinc finger, C2H2 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000021967   Gene: ENSORLG00000017558   Transcript: ENSORLT00000021968
Sequence length 354
Comment pep:novel chromosome:MEDAKA1:9:31451706:31458746:-1 gene:ENSORLG00000017558 transcript:ENSORLT00000021968 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AMGSVLPGSSRGLKPPPPPLSLADIITSDILHSFLYGRWRHVLGEQPQHHLQHEDLRTAP
SPKTAFTAEVLAQSFSGEVQKLSSLVLPSEVIIAQSSVPGEGLGIFSKTWIKAGTEMGPF
TGRLVSPEHIDLYKNNNLMWEVFNEDGTVRYFIDASQEDQRSWMTYIKCARNEQEQNLEV
VQIGSSIFYKAVETIPPDQELLVWYGNSHNTFLGIPGIPGGDEEQTKKSKSDELHTCDAT
SLGRMRCVICHRGFNSRSNLRSHMRIHTLDKPFVCRFCNRRFSQSSTLRNHVRLHTGERP
YKCHVCQSAYSQLAGLRAHQKSARHRPTGDGSNPELTAVPHPASLVHHIPTMVL
Download sequence
Identical sequences H2MT71
8090.ENSORLP00000021967 ENSORLP00000021967 ENSORLP00000021967

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]