SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000022111 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000022111
Domain Number 1 Region: 144-287
Classification Level Classification E-value
Superfamily PH domain-like 5.53e-42
Family Third domain of FERM 0.00031
Further Details:      
 
Domain Number 2 Region: 456-668
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 6.02e-37
Family DBL homology domain (DH-domain) 0.00046
Further Details:      
 
Domain Number 3 Region: 796-945
Classification Level Classification E-value
Superfamily PH domain-like 1.12e-31
Family Pleckstrin-homology domain (PH domain) 0.0026
Further Details:      
 
Domain Number 4 Region: 652-777
Classification Level Classification E-value
Superfamily PH domain-like 1.68e-26
Family Pleckstrin-homology domain (PH domain) 0.0075
Further Details:      
 
Domain Number 5 Region: 44-146
Classification Level Classification E-value
Superfamily Second domain of FERM 4.32e-26
Family Second domain of FERM 0.00015
Further Details:      
 
Domain Number 6 Region: 1-43
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000093
Family First domain of FERM 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000022111   Gene: ENSORLG00000017665   Transcript: ENSORLT00000022112
Sequence length 962
Comment pep:novel chromosome:MEDAKA1:21:25116724:25141717:-1 gene:ENSORLG00000017665 transcript:ENSORLT00000022112 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FFSLSSVHSKKLQVWLDPIKPIYKQFRRPKHAILKFSVKFFPPDHAQLLEELTRYLFALQ
IKQDLCCGRLTCNESSAALMISHIIQSEIGDFEESQCRSHLLNNNYIPDQMPLIDKIMEF
HSKHIGQTPAESDYQMLEVARKLDMYGIRLHPAKDRDRTKLSLAVAHTGVLVFQRHTRIN
AFNWSKIRKLSFKRKRFLIKLKPDLNSSYQDTLEFLMASRDCCKVFWKICVEHHAFFRLF
EEPKPKPKPVLFTRGSYFRFSGRTQKQVIDYVKESEFKKIPFERKHSRVQHNSHLSPLPS
PQHHQVPTEAGARQAEQNMVMNEGSNTSGSESSESEVENRGGCSSPVTFSNPVERNSPIP
RNKLSLGSLQLDEEADEDGSHTFSDEDNKPQFSNPPLHASAGLPHGMVNGQRSLDLGSHS
PNGRQPSPLTSPLLNDACSVRTDDEDEVRRKRFPTDRAYFMAKELLTTERTYLKDLEVVT
VSFQSAVGQDEATPDSLKETLLSTFEPLHKFHTGFLREVEQRLALWEGRSNAHIKGDYQR
IGDVMLKNLQALKPLTVNLSKQSEVLLKLEKACKASRRMDSLCRDFELQKVCYVPLNVFI
LRPLHRLIHYKQILESLCKHYPATHVDFRDCRAALAEVSEVVDQLQGNLVEMENLQKLLE
LKKDLIGVDNLVVPGREFIRLGCLSKLSGKGLQQRMFFLFNDVILYTTRGMTPTNQFRVH
GQLPLRGLTIRESEDEWGVPYAFTLAGQGQSVVVAASSLTEMEKWMDDIKMAVQMAKTSN
GPLSDLLTPSLADNKYPEDSSVEAESEDDMTASHTTLERPAPHRGNTMVHVCWHRNTSVS
MVDFSIAVENQLSGNLLRKFKNSNGWQKLWVVFTNFSLFFYKSHQDDYPLASLPLLGYSV
TIPSDNENIHKDYVFKLHFKSHVYYFRSESEYTFGRWMEVIRSATIPSSRGRALNSKEAH
PL
Download sequence
Identical sequences H2MTL0
ENSORLP00000022111 ENSORLP00000022111 8090.ENSORLP00000022111

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]