SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000022263 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000022263
Domain Number 1 Region: 501-563
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000287
Family Classic zinc finger, C2H2 0.02
Further Details:      
 
Domain Number 2 Region: 101-137
Classification Level Classification E-value
Superfamily SET domain 0.0000445
Family Histone lysine methyltransferases 0.026
Further Details:      
 
Weak hits

Sequence:  ENSORLP00000022263
Domain Number - Region: 152-181
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0217
Family C2HC finger 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000022263   Gene: ENSORLG00000017786   Transcript: ENSORLT00000022264
Sequence length 564
Comment pep:novel chromosome:MEDAKA1:9:32757416:32761145:-1 gene:ENSORLG00000017786 transcript:ENSORLT00000022264 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEESGSQKLVWDGDAKAVQQCLTDIFTSVFTTCDIPAHAIFGPCALSHTSMYDSIAFLAL
KSTDKRAAPYIFRVDTSAANSTSEGLMWLRLVQSARDKEEQNLEAYVKNGQLFYRSLRRI
EKDEELLVWYGTDLIDLLLLSSSRAPAKSKASAHHTCPDCNQRFQFEFPFLAHLRFRCSK
RLQGGGSADEESGRDRSTEHANSPPPRTSPKLGRSEGFGNPQDSTKPSTDFHNLARDLEK
NRTSPPSDKEAEICSESSGKRKFSDVDERESRRPGLLQTKSKDELEASAQNYRGVYSLEE
NQRSFSPPGSTDPGEAKRSAFTEVRKPPQNPKHHSSTRNSENKEGGRPSGNPPEKNLGIR
QVLSETQPPQSLSLGSAFTSVSQQGGGSGGERKSAFSQPSRSFSQISPLVMPPKLLDCHP
AVGDTISSSRLYQADHLAAKLQGAELGANCPVPGAMSKQNPFVYATAFWPKNSGPIQLQM
PSALTLLPPSFTSLCLPAQNWCAKCNASFRMTSDLVYHMRSHHKKEYAMEPLVKRRREEK
LKCPICNESFRERHHLSRHMTSHN
Download sequence
Identical sequences H2MU04
ENSORLP00000022263 XP_004072894.1.28442 ENSORLP00000022263 8090.ENSORLP00000022263

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]