SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000022287 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000022287
Domain Number 1 Region: 562-621
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000893
Family Classic zinc finger, C2H2 0.034
Further Details:      
 
Domain Number 2 Region: 1902-1928
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000689
Family Classic zinc finger, C2H2 0.016
Further Details:      
 
Domain Number 3 Region: 1590-1619
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000256
Family Classic zinc finger, C2H2 0.027
Further Details:      
 
Domain Number 4 Region: 394-443
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000379
Family Classic zinc finger, C2H2 0.027
Further Details:      
 
Weak hits

Sequence:  ENSORLP00000022287
Domain Number - Region: 1752-1780
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000451
Family Classic zinc finger, C2H2 0.0023
Further Details:      
 
Domain Number - Region: 613-659
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000461
Family Classic zinc finger, C2H2 0.02
Further Details:      
 
Domain Number - Region: 1863-1889
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00981
Family Classic zinc finger, C2H2 0.028
Further Details:      
 
Domain Number - Region: 513-538
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0243
Family Classic zinc finger, C2H2 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000022287   Gene: ENSORLG00000017808   Transcript: ENSORLT00000022288
Sequence length 2215
Comment pep:novel chromosome:MEDAKA1:24:20348905:20357789:1 gene:ENSORLG00000017808 transcript:ENSORLT00000022288 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
HENGISQLSLLSAVGQYEGIWTHGVLQGLLSNQDLQKDQGDEGSVLLQMRVKQLMKDKEL
AKAGQLAKTCSESSAFQGNTAFKQMYLVCLCSTAEQSQLMEELSKEDCSDALEMICNLES
DGDDSAAFSLCSAFLTRQLLQGDTYCAWELTLFWSKLLKRLEPSDQAFLDRCRQMSLLSK
TAYHILFFIKVIQSEIGSSGLSASIELCIRALRIKSDDAKLKATVCKTISCLLSDDLEAK
RACQLTEFLLEPTVDAYYAVETLYNEPDQKLEEESMPVPNSLRCELLLVLKIQWPFDPEF
WDWKTLKRHCLALMGEEASIVSSIDSLNDPEETEEEKELMSFMDHNNIPEHIMGGMSELE
NMEGRKQKNREIKKLKDKGYMSARFRNWQVYMQYCVLCDKEFLGHRIVRHAQTHLSNGTY
SCPICAQPFSSKDALIPHVTTHVKQSCKERLTAIKTNKNLNSRKVGLSSLSALKAKTQNN
LHKSSHSSVRSVVVKNVAPSAVRMDVDTNESNMCPVGNCRRSFKFFKNLISHVRLHGDDE
EAKTFLELQSKKVVCQYCRRHFLSVNHLSDHLQAHCGVNPYICIQLNCKASFESYSELLA
HRRTHTVFKAKCMFPTCGKVFTAAFRLYDHEALHYKTFTCKFAGCGKVFHSQQQLDIHRH
ATQVEEGKPEQSTEDVTREPAIAKHKSAIKEEPSQRTLNTKTAVDSNPRSLSACKESSQK
PSQEPAKVCKLETETTAVPVSQPSVLKSSVIQSMDSRSAEADRHRTDLSAHSFACGAHQR
KLPVVSLDSNAVSLFQKQSQALPSNVNTKATSYPSKSPLPVQNRPPLGRNPTPMLLPQAA
AKPAMSQPLPPSATLQQESANEPSSSSESSAPPSLKERFHCAFGACTRHYCSYRSVVKHM
KTTHSDFYEQWKVSKSNIRVTYVPASTTPSAGHLGPAPLLQKQQSGKIPAQGVQRENVIQ
SLPFKSTNFMNLLASLSHNQSSSALMENVLNPIVLSQLNNKNTAENQSAGQNWTPSAGSE
HVRSSSQPFSSNIQEEPRVPSAGAAPLPCSLMGQLINNPQSIITSYINHVSSSLDATARS
PDAMKSRANRNHFNIPLRNEATNSSKVSLPQNGRVVSENRPEMKNEKQVRKSRWPAIIKD
GKFLCRRCFRPFDSPKSLGGHLSKRALCTPHPNSEAHTEPSEQTVNPSQPTYSGTPANQK
PRETTRVAKDFSAPENRVSSDDILKQIMAESNLSDLFVPTSSPQPFIQNPCAAYGSGERP
QGGSVIQHTENVQLKQETDLYSKVFYPQQSVGLLPETRTLNPQLSQVLPENPSTAGTGRN
VSADERRRPETSIQTLKADATSVIQALTPDGGMAQGSSTHQTEKPNLPAENDIKKKLRDQ
ILAGEFQRRNSVPHFSSTDLKPQAYSPSSNFVFHRTSFEMSKDLSHRGPILKESARTFPG
SAVEVEQLLNKQSFTHFRESGVSKTEPWSPGGFSPIDPDPEPGELSASHVQCVSEIQHKF
ERLDLVRDMSNQMVTHRSQNCPYPSSQTSFPKAKTQSPVLPTAAKPFACDAGSCNFSSLS
SEALWKHLSKTHNYTCEMVNMVKKRYGKYAPFKCQKCNKSFTRNSNLRAHYLSCHKLSVK
EISDLDEKRRLAKATEALAFQSQIRAHQSTETPHLPVNDPIPEQAVVQHKTPAVPNPDHT
LQGRGHSLVLHPAVPMQSKGPPPAQTSGAPFPSEAMPQLQSTLLKGLSPEAANKTKKSKA
RKPKQADMIPYKPYSCVHHGCTAAFTIQQNLILHYRAVHHSALSALEINQALDKTDDMDE
VTDVDEEEAEAEFPEISEFRCQLKDCCCVFQEVSTLFQHYLRLHKLSLGKICSLLSAIKL
GRFVCSHQGCSESFLTSQKFISHMKEAHKDVNLGRTEHFNATFKCTFEGCDRAYATKSNM
LRHAMKKHGRLPSPEPKQPQVKGKPIKPSSKTLRYPISKASNGKENIESNKKVLLRTRDV
KRTVRSKSSHWTTYGKPSLKTKVEAAAMCTKKFPLQYPCMIKGCEFVTKAERSILKHYLV
HGLSEKYLELHRSHFIFCKKFPKLRNRFIRSEDSKSDKNSDGSDNEVAAEPMLEEGQQDD
SKPILRRRTPVAITVPLFDKMPTKRRSERSLLLKRKRGRPRKYMEKMVKSKKILRTAKTE
PVSKHEEPPVVQEMSERSAPLASFTPMGFEMSFLKFLEQSNKSEQTEQSKNRAKD
Download sequence
Identical sequences H2MU28
8090.ENSORLP00000022287 ENSORLP00000022287 ENSORLP00000022287

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]