SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000022424 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000022424
Domain Number 1 Region: 44-94
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000205
Family Classic zinc finger, C2H2 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000022424   Gene: ENSORLG00000017917   Transcript: ENSORLT00000022425
Sequence length 109
Comment pep:novel chromosome:MEDAKA1:21:27009480:27013409:1 gene:ENSORLG00000017917 transcript:ENSORLT00000022425 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTKPSRLTDVGGRSCSVLDSVRRARLKQLRGPRSQAPKAPKTAHACLQCSADYKDCVALI
MHRLRHIEGKHWPCPLCSKTFFRLRNVRNHIRTHKPKLYKCRSCIAAGS
Download sequence
Identical sequences H2MUG0
ENSORLP00000022424 8090.ENSORLP00000022424 ENSORLP00000022424

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]