SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000022708 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000022708
Domain Number 1 Region: 204-254
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000756
Family Classic zinc finger, C2H2 0.0076
Further Details:      
 
Domain Number 2 Region: 1730-1778
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000492
Family Classic zinc finger, C2H2 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000022708   Gene: ENSORLG00000018133   Transcript: ENSORLT00000022709
Sequence length 2251
Comment pep:novel chromosome:MEDAKA1:24:23427343:23448065:-1 gene:ENSORLG00000018133 transcript:ENSORLT00000022709 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDPHDSTVTRQKGSNRDEVKEKIPLQRKWASEPSANTKQNTFCDPEVKHRESLPCGAMRG
STPQQKYPMTGNPVQLLSGPSGVGAIGGPPSADPQGPLTQGFPRGYPYQLGQPYPQHPQT
ERFISGAKPQPGLESHAWPFAGQLPSDDPYGHPGHTHLHKAGRFPRQKSPSLPSSFGQYS
QSGLEPGEEGYSKKEQKPKKPGKYICHYCGRACAKPSVLKKHIRSHTGERPYPCEPCGFS
FKTKSNLYKHRKSHAHAIKAGLVPFSSELAVTHSEDVGQASPVGEGEAPSDGEQSTDTDE
EGVEGSTMLMEKHSPIPQISFEANKTAGGGEPAYADSAEEFHIGSMKVPILIFPKPGVVP
PGGMDCPTFHDAKVSHHMLASQAGGRSHSLDDSSSSKRLAQRMDEKKVQDSDPSISQSLN
LLSPHSKGSTDSGYFSPYDSAELQIGTPNTSAKTYEEIMFGRTWYNRPNSRPRQSMTVGM
AAADGNGSLKQQDLDMCKIAEDPSSFKESLGMSGDAKKYPTGPCQSSTGLLEPPSESGTL
IRSRSMPAPVPSNLNTPQGIRGSISFDNMVPADDVFYPPGQPKLKRQSAFEHPANESHPG
EAEGHPHMAKGLASSVGLKITERCPGGPEDIFYNQHPSRVSISEIATRKRRKEKSVGDDE
DSPENCDSSFSSSVDIIGDYDFKQGSFDGSRGTPTGKSSFHSTHSQSDSFDTCVSMCSDD
IVPFPDSEGRKPAGNVISVIQHTNSLSRPNSFEKSESFEQPVHQPSDKAPSSQYSEQSDT
DIYEDALSPESALQRAESMEQQQSDSDLASFSSSSAAASPGQPYHKLVRQPNIQVPEIRV
TEEPDKPEKDTEPLVTKEPEKQPPAVEEFQLPQRSDTLSQMPTEKLPPKKKRLRLADMEY
SSGESSFESTCTSLSRSPSQESNLSHSSSMSMSFEKDEGVKSVSPTKQEDSLANGSGAKQ
SEFLTVPSSFSSHHQQREMRRSSSEQAPCTLPTELPEMRSKSFDYGSLPSCRQGEVYTST
SAKKERRRGYLVRQASLSVYPEGVLQDIGGGQVSIKQENLEHGVWPIPSGSPHSSSEMAI
RTRRPGNITVVGSHQQPPQHVFRQSISDDSLQDEPCFGRPKQHRLQAQGSSSEGEHPVLE
VRNRDLIQQYQGGVPFAPFSQPCAFWNQEAEKAARQQQQLQKLHLRSPSSLPGPAAPKQS
AQQVYDPQLYEGKTEHQSTHIYSPSFPSHINMLSPANSVLQRHLQPTQNLSSKTTSPGLV
VPVRIQTYVPVFGSATYTSVSQFMSCHANEADALGADRCENSTLGGVRPCNPPGGISRSG
FNLSLLLGHTDSDLLRSSFWKGSEKHLNTGIPLSLTSGTISTTDASGSAIGGGKRMLSPT
SSLELFIQSKQQKRVKEERMYGQIVKEMSAVELSGAERGTTPEKQGGSNQRAPLRSKDSV
DECERMSSSPPLSDPPAATKIAVPVRSSAPHLSDVPQGDSFPPPLQIVTERGLVSCSQDS
PERLDVDDVSPGPSSSPEPMLSSSDAESSDKQALLLKPAPTHSSGMTGGAQSLLFTNLSE
VQQLLHFPSLRTTSRVSWCFRNYTKPNSTQAASHCSVYSSWSVSTHNPNPLNISTKAALA
LLRSKQRENTEWLFTLAAMCPPSSGKLVSSVAWKLMFDQLKPDLGPADLNCFGRKMKGVE
SWERSKVELGEKVASAKQLSTEPTRIKIFEGGYKSNEDYVYVRGRGRGKYICEECGIRCK
KPSMLKKHIRTHTDVRPYVCKFCNFAFKTKGNLTKHMKSKAHIKKCLELGVSMSSVEDTE
AEELTQTEIVSHFLLSFRADKQAVDKNLSQFTSKEGQRRHKCQSDSDRQEGDSTPKTGSR
SCSPQLYALPPMSIAHVATLNPAPHLLHPTATDLLGTPPRPPLLGYFTTVPSIQITPQAQ
PSDAAGRERLQAEDPGCQLQPLGSRLLALPSSSMDEDLPDLSSPSSRLSSPGLEPPGCPS
PISPSSSPSTHRYLSPCRNLSPSARHLSPRRDISPLRHISTAGGYRRDLSPRRRHAVVSP
LSRPLSPRGRDYKRDLSPQGQHKRMIRHVSPCRGPLHQSFVVPKSLIFQKRSKLFLGINV
KLLSRCVDEKIQKHFRSNQNNLSSAPLQVLFSHLPLHSQFPMPSSLPLIPIGGIHMVNFA
PTPIGSCLDQQGGASAVSHLTLQKSTSEDSNCGEANFPHFSSISKRRGPAEGQGAREASS
PQQREGGGVRLEQEEGIQTCTQAIASLCIDS
Download sequence
Identical sequences H2MV82
ENSORLP00000022708 8090.ENSORLP00000022708 ENSORLP00000022708

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]