SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000022711 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000022711
Domain Number 1 Region: 43-73
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000595
Family Classic zinc finger, C2H2 0.062
Further Details:      
 
Weak hits

Sequence:  ENSORLP00000022711
Domain Number - Region: 5-38
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00131
Family Classic zinc finger, C2H2 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000022711   Gene: ENSORLG00000018137   Transcript: ENSORLT00000022712
Sequence length 890
Comment pep:novel chromosome:MEDAKA1:22:25290705:25303782:-1 gene:ENSORLG00000018137 transcript:ENSORLT00000022712 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEGDRKCILCEIVCVSKQEMDEHIRSMLHHRELEKLKGRDCGHECRVCGVTVVSLTEYAS
HISSSWHKQNVDKSPGGGELSQENFDQALVDLIQKRKDKIRKEKEAAAAKVAKEEEERRK
KEEFQQKLQDAKDRYRLARARQPPLQGYRHQFSCYQNQASGEEAKAGQHVKKGKGATWHA
QAPPDLQKWASGDLTTEGMKHPGGGSSKTWGHGALFRSQQNYLPWLNSGGSSHGLYGHNN
RNMGAPPFCDWLKQTLQDPGARGVGSEHSSRTNGSNPVPDKGCRWSPYPVTPAPQAEAHP
HALEISQGPKTKQEKTAETGAFICSRQEKSGGRKVNSAPKDESKASGFHREASVSSQQAE
AQHTGSQRPMSESSTTAQHTGSQRPMSESSTTAQHTGSQRPVSESSTTAQHTGSQRPMSE
SSTAAQHTGSQRPVSESSTAAQHRGSQRPVSESSTAAQHTGSQRPMSESSTTAQHMGSQR
PVSESSTAAQHMGSQRPVSEFSTASLQTRSRRPIPESSSTDNNPSPQSLLVSTSVLDSPW
PGGSVREEEEDGKDEAVGLGQSLNSDPSRGAEAASPSSKLDLPHVLKRDLSKHISSKNKA
GGHEPNLNIARRVRNLSGSRKHEADRDSGLKPTVRQLLSSSASRRCVNWEQLYDELRKKQ
DKGKGMPRFGIEMVPNEQDCPRQEEEALLEGFDWDLVTTRKRSLSESSLAPSSSSLLAPC
VSEEPPQRMHLSSEQQSAASPPQQRLAAHRQPDTLMSASVKVLQRSESVGGDSSSGMEQC
DGQGSCKRRRAATDGQSAEASCLEHNSKRRKVKSKKERLHIDQLLSVSLREEELSRSLQT
LDSNLIQARAALEAAYMEVQRLTLLKQQITVQMSTLRNTRIDLLKGMQGK
Download sequence
Identical sequences H2MV84
8090.ENSORLP00000022711 ENSORLP00000022711 ENSORLP00000022711

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]