SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000022775 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000022775
Domain Number 1 Region: 213-315
Classification Level Classification E-value
Superfamily SRCR-like 3.27e-36
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00032
Further Details:      
 
Domain Number 2 Region: 324-433
Classification Level Classification E-value
Superfamily SRCR-like 1.83e-28
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0012
Further Details:      
 
Domain Number 3 Region: 82-195
Classification Level Classification E-value
Superfamily SRCR-like 3.4e-20
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0026
Further Details:      
 
Domain Number 4 Region: 2-45
Classification Level Classification E-value
Superfamily SRCR-like 0.0000000000196
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000022775   Gene: ENSORLG00000018185   Transcript: ENSORLT00000022776
Sequence length 655
Comment pep:novel chromosome:MEDAKA1:22:25808243:25829311:-1 gene:ENSORLG00000018185 transcript:ENSORLT00000022776 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GKIWLDNVLCNGGEKSIDSCKSRGWGNSDCTHDEDAGIICKDERIPGFVDSNIIDAQVDE
FKVEEVRLWPVVATARKKMPITEGVVEVKHRNGWAHVCDLGWTVQNTRVICGMLGFPHER
KVNKNFYKNLWDFGFLVPPSTPRLYLERQKNQILVHSVSCTGTEVHLAACPLEYSKPNST
SFCLGGMPAVVSCMPGPLFLQNSSIKKKVKVSTNVRLKGGSKVGEGRVEVLKDRDWGTVC
DDRWNLQSASVVCRELGFGTAKEALTGARIGQGIGPIHMNEVKCVGHERSIWMCPYKNIT
AEDCQHTEDAAVRCNVPYMGLENSIRIVGGRSSYEGRVEVQVGSKWGTVCSSGWTTKEAM
VVCRQLGLGYSMHAINETWYWDSSNVTQMVLSGVRCTGEEMSLSHCQHHKTVSCQKSAAK
FAAGVICSETASDLVLNAPLVQQTVYIEDRPLHMLYCAAEEDCLSKSAAKANWPYGHRRL
LRFSSEIRNIGRADFKPKAGRHSWVWHACHGHYHSMDIFTHYDLLNANGTKVAEGHKASF
CLEDTDCQEGVSKRYECANFGEQGITVGCWDLYRHDIDCQWIDITDVKPGNYIFQVVINP
NYEVAESDFSNNAMKCNCKYDGHRIWLHNCHLGGALSEEAERLFEKYPGQLNNKV
Download sequence
Identical sequences H2MVE5
ENSORLP00000022775 8090.ENSORLP00000022775 ENSORLP00000022775

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]