SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000022887 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000022887
Domain Number 1 Region: 29-265
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 3.64e-79
Family Eukaryotic proteases 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000022887   Gene: ENSORLG00000018277   Transcript: ENSORLT00000022888
Sequence length 267
Comment pep:novel ultracontig:MEDAKA1:ultracontig276:231088:237173:1 gene:ENSORLG00000018277 transcript:ENSORLT00000022888 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PSIIYLTSQCFKLILKTELAGVRAFPPELEMETRIIGGQEAWAHSWPWQVSLQFSTMPTC
GGAIIAPEWVVSAAHCFSRFNTESLWTVLAGKHDLDKPQETEEQRVQVSKIVTHHQYNTR
TKECDLALLKLERPLVFSPHVSPVCIPEEDEELDDSWTCVVAGWGKVQTSEALNPDRLHH
AELTLVNESTCIQKWGDLITDYHICSHPVGSASCMGDAGAPLFCRKHDSYFLFGVVTWGS
WRCSANKPAIFTRVADFLSWISDVIDV
Download sequence
Identical sequences H2MVP1
ENSORLP00000022887 ENSORLP00000022887 8090.ENSORLP00000022887

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]