SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000022917 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000022917
Domain Number 1 Region: 556-812
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.16e-88
Family Eukaryotic proteases 0.00000648
Further Details:      
 
Domain Number 2 Region: 301-406
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.62e-23
Family Spermadhesin, CUB domain 0.00057
Further Details:      
 
Domain Number 3 Region: 186-295
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.57e-21
Family Spermadhesin, CUB domain 0.0011
Further Details:      
 
Domain Number 4 Region: 484-520
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000209
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 5 Region: 412-448
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000563
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 6 Region: 446-482
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000209
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 7 Region: 49-143
Classification Level Classification E-value
Superfamily SEA domain 0.00000000405
Family SEA domain 0.011
Further Details:      
 
Domain Number 8 Region: 525-564
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000407
Family LDL receptor-like module 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000022917   Gene: ENSORLG00000018299   Transcript: ENSORLT00000022918
Sequence length 814
Comment pep:novel ultracontig:MEDAKA1:ultracontig90:7974:22404:-1 gene:ENSORLG00000018299 transcript:ENSORLT00000022918 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LLEAPDKTRVEKISGRTRKVSLIVGLVVCAAVLALVTGLLVWHFHLRRDIRVQRVYVGSI
AIKDVLFKTEYEDPRSSEFQKMASLVVKELKLLYSSYSVLNQYLRTSRIQAFSDGDDNGI
VAYYHSEFELPVSKQASLDEAIKTLEPSEDKMLEKFLRLNSLLEKTLDPRMGRALVSEKA
TTKIHITGEGGLLQSPGFPDTPYPSNLSQQWLLQADPRHRVKLDFHTLILEDDCQHDFLK
IYDSLVPIELCALTEQCGYPQESLTFLSSGNVMLLTLVTNQEKNFPGFRAFYSQVPLDSG
ECGGRLLGEKSSFSSPFFPSNYPPKASCQWDIQVSKERFIKLEFEKFAVGNQSEECLHDY
LEVDQDRFCGRKLKSSFIIIKSSKATVTFQSGSSYVDQGFLIRYESFIPSDPCPKQFRCS
SNLCINTTLQCDGWNDCGDNSDEMSCICRKSYIKCKNGLCKPQMWTCDGYNDCGDGTDEE
NCNRCKDGGFLCRSGRCISQSLKCNGENDCGDGSDESQCKRSLVLGCSEFTFRCANGRCI
SKINPECDEEQDCEDGSDEADCSCGIVPFRSSRVVGGVVSKEGEWPWQVSLHFKGEGHVC
GASVLNNRWLLTAAHCVQDSQVKRYSEAHHWEALLGLHVQGQTNEWTVKRRVRRIIAHED
FSYETYDNDIALMELDADVRLNQYIWPICLPSPAHDFPAGQEAWISGWGATSEGGFREKF
LQKAAVRIVNTTVCSSLMEDQITDRMLCAGVLEGGVDACQGDSGGPLTVQKNRDERAFLA
GVVSWGEGCGQKNKAGIYTRVTKFRSWIKENCGL
Download sequence
Identical sequences H2MVR8
8090.ENSORLP00000022917 ENSORLP00000022917 ENSORLP00000022917

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]