SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000022958 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000022958
Domain Number 1 Region: 128-175
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000358
Family Classic zinc finger, C2H2 0.032
Further Details:      
 
Weak hits

Sequence:  ENSORLP00000022958
Domain Number - Region: 70-124
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0232
Family Classic zinc finger, C2H2 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000022958   Gene: ENSORLG00000018336   Transcript: ENSORLT00000022959
Sequence length 1214
Comment pep:novel ultracontig:MEDAKA1:ultracontig231:407102:410746:1 gene:ENSORLG00000018336 transcript:ENSORLT00000022959 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QQGAVFSGKILSFGCSVCKDSSTYSPNDLLKHFRAAHKGTLPTYPCDLCDFVTNEFPALQ
RHRMEHRNTLVTCELCNDNTQYSLLLITRHYMMSHSTNGQFKCDWCEFRTSDAGTFVQHI
HRHNDSHWKCSKCRHISLNEEDHQSHMKAHSKTFPFTCQVCGYGATSSEYLRKHRASVHK
DMSETTNTWKVAEDALANFSANSKQTFKKSGESLETLRIFNPSCVSSSVQNQTSRSVKPD
LPEALHCSEGSPVKKDHRVWSKSPESTEQSATVGLEESQNTDAGCHTNANGLTVLMVKNK
ISLPPNCTTKVMGFKVVDGKKHLVLKVIPSAKQDLMAKSNCLVSDVSLLPKPVLDRGKVS
ETKENSDSRSSAVSPRTGSCGSGVHQGDVMAIQVKIEEETSVCSVNVDDQTNGLHSSITT
CADTMTSVTKDSCHVCNQIHLNEARCTEERNNLSLVSCVSTAARQISAVLSNSSQISASK
VKSVSTPSDLQRAKNLSSGLRKSAENFGAVNLSSQADKTSNFKQNQQNVTDLDSSPWSLQ
TSLLSNGECASGTGKTIQNTLNQEVFTFHNYSKETFSMSPKPPQDLDCNPNLSDCESKCE
PSLFSLTLTESPERLTESSEEDIEVDECVASVADQLNEDHSDSVLQNLNIVKVEEDIVSI
SATQPELQSCLTSMGCFVEEHSDAIVSQQLHRERRGPSRTSNNSLKQATNSHVLQLPERK
QPILLRAAENRFSVPVKVNPSPGFRLLTNSKKSLINVSYIRPGMNKSNNVGVAPTKLQSD
ENRTTLASVLQPSTNPTQNHYLINRAGFKGPTLVPSSSNTPPEVKMAKTQQTCYLVQRSV
PVKSPGGPVLKMASASQENPHPVLAVPVNPAEKPSGRQSFLLRYISPKSGLCLNNQETKT
RNLSSQTGENSGNKVIFKIVSPSGSLLTSGSPTSRGQPLFLATRPKTQCFLVSSNKTDAP
AYSGAKTLIGLKNSAQKDVKKCDILLSQILPQAQQCEAEKLALAPRSIRPPSQRKRCRKT
FEEPATMVHKARRVSNTLQIEKDTPALWIPAAKEVERTLKLAPFSSVQRIKCPRRYQPVV
VLNHPDADIPEVANIMKIVNRYRGAVTKVSLCQKTLQALSDLGVPDEDSTLSNEERLRPR
LIQTFARERFLLKMKLRRKNKKKYEVVKPSSGCRQSTVLFDCWFCGRIFTNQEDWIGHGQ
RHLMEATRDWNKLF
Download sequence
Identical sequences H2MVV3
ENSORLP00000022958 ENSORLP00000022958 8090.ENSORLP00000022958

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]