SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000022968 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000022968
Domain Number 1 Region: 139-196
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.39e-22
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 2 Region: 224-280
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.53e-22
Family Classic zinc finger, C2H2 0.007
Further Details:      
 
Domain Number 3 Region: 101-153
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.64e-18
Family Classic zinc finger, C2H2 0.0061
Further Details:      
 
Domain Number 4 Region: 269-321
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.85e-18
Family Classic zinc finger, C2H2 0.0029
Further Details:      
 
Domain Number 5 Region: 186-218
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000086
Family Classic zinc finger, C2H2 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000022968   Gene: ENSORLG00000018343   Transcript: ENSORLT00000022969
Sequence length 326
Comment pep:novel ultracontig:MEDAKA1:ultracontig49:64838:67291:1 gene:ENSORLG00000018343 transcript:ENSORLT00000022969 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QRENVGVFQEEEEELSLKQEPETPEESEPSEAEEPDLVVIKEEEDDFFVDQAEEQVRLKQ
EFGTFTVTRPNEENDHSGPEPSRARLLFGSSSLAESDACGKSFLCDKCGKGFRQQGHLNS
HIRIHTGEKPYLCKTCGKSFSQSSVFRNHIMIHTGEKPFSCKICGKLLRYSSSLTGHMKI
HTGEKPYVCKVCGKRFCHSSGLVSHTRSHTGEKSYSCQVCGKCFSHNSTLLRHTRTHTGE
RPFPCQTCGKRFNNNSHLTIHMRTHTGEKLFSCDACGKSFSHGSTLQRHARMHTGEMPSS
CKVCGKLFRYSSSLARHMKIHAGDKP
Download sequence
Identical sequences H2MVW2
8090.ENSORLP00000022968 ENSORLP00000022968 ENSORLP00000022968

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]