SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000022986 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000022986
Domain Number 1 Region: 351-403
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.87e-16
Family Classic zinc finger, C2H2 0.0094
Further Details:      
 
Domain Number 2 Region: 538-570
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.01e-16
Family Classic zinc finger, C2H2 0.0025
Further Details:      
 
Domain Number 3 Region: 289-344
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.17e-16
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Domain Number 4 Region: 251-303
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000971
Family Classic zinc finger, C2H2 0.019
Further Details:      
 
Domain Number 5 Region: 476-528
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000362
Family Classic zinc finger, C2H2 0.002
Further Details:      
 
Domain Number 6 Region: 423-449
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000558
Family Classic zinc finger, C2H2 0.0019
Further Details:      
 
Domain Number 7 Region: 455-485
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000235
Family Classic zinc finger, C2H2 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000022986   Gene: ENSORLG00000018357   Transcript: ENSORLT00000022987
Sequence length 757
Comment pep:novel ultracontig:MEDAKA1:ultracontig72:341588:352749:1 gene:ENSORLG00000018357 transcript:ENSORLT00000022987 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVAGQTQQQLMDAGVGVAVDGGAGVDMMVMDSLDPTLLQMKTEVMDAAVGASSPSAAVVG
GVAGAAHQATVTTVDQTQIITLQVVNMEEQAALGIGELQLVQVPVSATTVEALQQGTFVD
ASSIPKDGDPVICHTLPLPEGFQVLEDQKGFSRSVRAHQHSAGAPMQPPNNDPSWAKDPD
YQPPSGVVKKVKKGKKSRLRYAEGDKDMDVSVYDFEEEQQEGLLSEVNAEKVVGNMKPPK
PTKIKKKGVKKTFQCELCSYTCPRRSNLDRHMKSHTDERPHKCHLCGRAFRTVTLLRNHL
NTHTGTRPHKCTDCDMAFVTSGELVRHRRYKHTHEKPFKCSMCDYASVEVSKLKRHIRSH
TGERPFQCSLCSYASRDTYKLKRHMRTHSGEKPYECYICHARFTQSGTMKMHILQKHTEN
VAKFHCPHCDTVIARKSDLGVHLRKQHSFIETGKKCRYCDAVFHERYALIQHQKSHKNEK
RFKCDMCDYCCRQERHMVMHRRTHTGEKPFGCSQCEKTFRQKQLLDMHFKRYHDPNFVPT
AFVCPKCSKTFTRRNTMARHAENCSGEVDDAENGAPTPKKGRRGRKKKMRSRRDEDDSDE
DQLEPDDEDEAEEEEEASLLLEEDEPESLELDQAPAAVPVPAPEEPPVKRKRGRPPKNAP
KVPAPSKPVRTPSKTSSAAAVIQVEDESTGAVDIIVKKEEADGAAEAPLQGGVALAVEDA
AMDAEGAETVELADGEETVAAANGDLTPEMILSMMDR
Download sequence
Identical sequences H2MVX9
ENSORLP00000022986 ENSORLP00000022986 8090.ENSORLP00000022986

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]